KEGG   Arthroderma benhamiae: ARB_07814Help
Entry
ARB_07814         CDS       T01611                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
abe  Arthroderma benhamiae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARB_07814
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ARB_07814
Enzymes [BR:abe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ARB_07814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 546 aa AA seqDB search
MSFVEQEEQKFLQDVEQVKNWWKDSRWRYTKRPFTAEQIVAKRGTLTIDYPSNAQSKKLW
KILEGRFASTPLTLVKNKDASFTYGCLEPTMLTQMVKYLDTVYVSGWQSSSTASSTDEPS
PDLADYPMNTVPNKVNQLFLAQLFHDRKQREERLRAPKEQRNSLPNIDYLRPIIADADTG
HGGLTAVMKLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQAD
IMGTDLLAIARTDSEAATLITSTIDPRDHAFIVGSTNSSIEPLNDLMVAAEQAGKNGAEL
QQIEDEWTSKAGLKRFQDAAIDQINASPSISNKKAAIDKFLADIKGKSNSEARAIAKQLT
GSDIYWNWDSPRTREGFYRYQGGCECAINRAVAYGPFADLIWMESKLPDYAQAKEFAEGV
HAVWPEQKLAYNLSPSFNWKTAMPRDEQETYIRRLGELGYSWQFITLAGLHTTALISDQF
AKAYAKQGMRAYGEMVQEPEMDNKVDVVTHQKWSGANYVDELLKMVTGGISSTSAMGKGV
TEEQFK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgttgaacaagaggaacagaagttcctgcaagacgttgaacaagtcaagaac
tggtggaaagattcaagatggcgatacaccaaacgtccattcaccgcagagcaaattgtt
gccaaaaggggtaccttgacaattgattacccatcaaatgcacagagcaagaagttgtgg
aagatcctggaaggtagatttgcgtcaaccccgctaactctcgtgaagaacaaagatgca
agttttacttatggttgcctggaaccaaccatgctcacccagatggtgaaatatttagac
actgtctatgtttctggttggcagagctcatcaactgcctcctcaacagatgagccttct
cccgaccttgctgactacccaatgaatactgtgccgaacaaggtcaaccagcttttccta
gctcaactgttccatgacagaaaacagagagaggaacgtctccgcgcccccaaggaacag
cgcaacagcctaccgaacattgattatctccgtccgattattgctgacgcagacactggc
catggtggtctgaccgctgtcatgaagctcacaaaactatttattgagcgcggggctgct
ggaattcatattgaggatcaagcccctggtacgaagaagtgcggacatatggctggaaag
gttcttgtcccaatcagtgagcatatcaaccgacttgtagccattcgagctcaagctgat
atcatggggactgaccttctggctatcgcgcgaaccgactccgaggcggcaaccttaatt
actagcactattgatccccgggatcatgctttcattgttggatccaccaactctagcatt
gagcctcttaatgatctgatggttgctgcagagcaggcgggcaagaacggtgccgagctt
caacaaattgaggacgagtggaccagcaaggctgggttgaaacgtttccaagacgcagcc
attgaccaaataaatgcttccccttccatctctaacaaaaaggctgctattgacaaattc
cttgctgatataaagggaaagagcaactctgaagctcgtgctatcgccaaacagttgact
ggttctgacatctactggaattgggattcgccacgaactagagaaggattttacagatac
caaggtggatgcgagtgtgccattaaccgtgccgttgcatatggcccattcgctgatctc
atttggatggagagcaaacttcctgactacgcgcaagccaaagaattcgccgaaggtgta
catgctgtctggcccgagcagaaacttgcatacaacctctcgccttccttcaactggaag
acagctatgccccgcgacgagcaagagacttatatccgtcgtctgggagagcttggctac
agctggcagttcatcacccttgctggtctacacaccactgccctgatatctgaccaattt
gccaaggcatacgctaagcaagggatgcgtgcatacggagagatggttcaggagccggag
atggataacaaggtcgacgttgtcacccaccagaaatggagtggtgcaaattacgtggat
gaactattaaagatggttaccggtggcatcagtagcactagtgccatgggtaagggcgtt
actgaggagcagttcaagtag

DBGET integrated database retrieval system