KEGG   Trichophyton benhamiae: ARB_07820Help
Entry
ARB_07820         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
Organism
abe  Trichophyton benhamiae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 446 aa AA seqDB search
MADLQGRKVFKVFNQDFIVDERYNVTKELGQGAYGIVCVVTQEQQQQQRIEQRATANATW
ETDSAASNIQTNDGVAIKKVTNVFSKRILAKRALREIKLLQHFRGHRNITCLYDMDIPRP
ENFNEVYLYEELMECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGN
LLVNADCELKICDFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWS
VGCILAELLGGRPFFKGRDYVDQLNQILHYLGTPTEETLCRIGSPRAQEYVRNLPYMHKQ
PFARLFPNANPDALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPNCPTPFDFHF
EVVDDVQEMRRMILNEVQRFRDHVRQPSHIQAALAQQLQPQQTNVPIPEDKGAWRHEDPR
PQEAVFDGTSEHDLEASLHRGMDMIR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcttcaaggacggaaggtcttcaaggtgttcaaccaagactttatcgtcgat
gagcgctataatgtcaccaaggagctgggccagggagcctacggcatcgtctgcgtcgtc
acgcaggagcagcagcaacagcagcgaatagagcaacgagcaacagctaatgcgacctgg
gaaactgatagtgctgcctccaacatccagaccaacgatggtgtggccatcaagaaagtc
acaaatgtgttcagcaagcgtattctggccaagcgggccctgagagagatcaagctgcta
cagcacttccgtggccatcgcaacatcacctgtctctatgatatggacattccgcggccg
gaaaacttcaatgaggtgtacctgtatgaagaactcatggagtgcgatcttgcggctatc
attcgatcaggacagccccttacggacgcccatttccagtctttcatctaccagattcta
tgtggactaaaatacatccattcggctaacgtgctgcaccgtgacttgaagcccggtaac
ctattagtcaacgccgactgtgagctgaagatttgcgactttggccttgctcgtggattc
tcgattgacccagatgagaatgctggatacatgaccgagtatgttgcgacaagatggtac
cgtgctccagagatcatgttgagcttcccaagctacaccaaagccattgatgtgtggtcc
gttggatgtattcttgccgaactgcttggtgggcgacctttcttcaaaggccgtgactac
gtcgaccagctaaaccagatcctccactaccttggaacccccaccgaggagactctctgc
cgtatcggctccccacgcgcccaggagtacgtccgcaacctaccctacatgcacaaacag
cccttcgccagactattccccaacgccaacccggacgctctcgatctcctcgaccgaatg
ctcgcctttgacccttcgtcgcgtattagcgtggaagaggccctggagcatcgctacctg
cacatctggcatgatgcgagcgatgaacccaactgccctacccccttcgacttccacttt
gaggtcgttgatgatgtgcaggagatgcgacgcatgattcttaacgaagtacagcgtttc
cgcgaccatgtgcgccaaccttctcatatccaggctgctcttgcccagcaactacaaccc
cagcagaccaatgtgcctatcccagaggacaagggagcttggagacacgaagatccacgt
ccacaggaagcagtgtttgatggaacgagcgaacacgatcttgaagcatcattacataga
ggcatggacatgattagataa

DBGET integrated database retrieval system