KEGG   Arthroderma benhamiae: ARB_07895Help
Entry
ARB_07895         CDS       T01611                                 

Definition
protoporphyrinogen oxidase, putative
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
abe  Arthroderma benhamiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARB_07895
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ARB_07895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 455 aa AA seqDB search
MRIGTKSAALSNRYIYYPDHLVRLPGPGGGVSFFDTLRDMLQEPAYEGLLRSLLGEPFKD
CRDPKVRDESVASFLLRRFGPALVDNLTSAFLHGVYAGDIDKLSMKATMRQLWDDEFGPG
IIINLMNKSLSRKPVYYKHNRIQVLRAIRREYSSEFNIRVGLMFAPGYILYLEGGMRSLV
SALSRELTRLPNVEIVRNAAVTHIQYDKAKASMIIKLSSAINKPPARYDYVISTTPSTVL
ADQLRGPGGRTPPTATSRMLAANDYAVSVMVVNLFYKNPDLIPTQAFGYLIPRSVPFEQN
PERALGVMFASHAVRGQDSAVGTKLAVMIGGHWWDGWNKSDLPDEQAGIAMAKSVLARHL
GIVDEPVVAKARLQYKAIPQYTVGHCDRMEDLHEDLCRDYDSRLKVAGAWYTGVGVNDGI
TAGRAIATALHAGNTKETGLEDYVNPTQPVLAAVL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaggatagggaccaaaagcgctgctttaagtaaccgatatatctactacccagatcac
ctcgttcggctccccgggcccggcggcggcgtatccttctttgataccctacgggacatg
ctgcaggagccagcatacgagggcttgctaagaagcttgttaggcgagccatttaaggat
tgtcgggacccaaaggtccgcgatgaatcagtagcaagctttcttctcaggagatttggc
ccagcccttgttgacaatcttacttccgcgtttctccatggagtctatgccggtgatatc
gacaaactcagcatgaaagctactatgcgccagttatgggatgatgagtttggacctggc
attattataaacttaatgaacaagagcctatctcgaaagcctgtttactataaacacaac
aggatacaggtactgagagccataagacgtgaatactcttcagaattcaacatccgagtg
ggtctaatgttcgctccaggctatatcttgtacctggagggtggaatgcgttcccttgta
tcagctctgtcccgggagctgacaaggcttcctaacgttgagattgtgcgaaatgccgcc
gtaactcatattcagtatgacaaagccaaagcgtctatgataattaagctctcttcggct
ataaacaagccaccagcgagatatgactatgttatttcgacaactccatccacggtactg
gcagaccagctacgtgggccgggggggcgaactccgcccactgctacttcgaggatgtta
gcagcaaatgactatgccgtgagcgtcatggtggttaatctcttctacaagaaccctgat
ctcattccgacacaagcgtttgggtacttgatacctcgctctgtgccttttgaacagaat
ccagaacgagcattgggggtgatgttcgccagccatgcagttcgtggccaggacagcgcg
gttggaacaaagttggcggtgatgataggtggccactggtgggatggatggaacaagtct
gatctgccagacgagcaggcaggcatcgccatggcaaaatcagtactcgctcgccatttg
gggattgttgatgagccggtcgtcgcaaaagctcgactgcagtacaaggcaataccgcaa
tacactgttggacattgcgatcggatggaagatttacatgaggatttatgccgggattat
gactctcgtctcaaggttgctggcgcttggtacacgggtgtgggagtgaatgacgggatc
actgctggtcgagcaatagccaccgctctccatgctggaaatactaaggagaccgggctg
gaggactacgtgaatcccacacagccagtgcttgctgccgtcctatag

DBGET integrated database retrieval system