KEGG   Acinetobacter baumannii TYTH-1: M3Q_1260Help
Entry
M3Q_1260          CDS       T02261                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:abh00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:abh00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:abh00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358616..1359938
Genome map
AA seq 440 aa AA seqDB search
MKTPLPDYLANVIEACDIDNSGHLADYIPELANANPNRLALAMSTVDGEIYSVGDDDVEF
TIQSISKPFVYAYVLQQLGIDAVLAKVGVEPSGEAFNEISLGKDGRPKNPMINSGAITVH
SLIQVKHGLHSAEILRRFMSELAGRELSFDESVYDSEVKTAYRNLSIGYMLRTVGILETD
PVDIVNGYIRQCAIMVTVKDLVRMGSVLANGGVDPKTGKRLLNRSVVRQVLSVMMSCGMY
DAAGDWLSTVGIPAKSGVAGGILGVLPGQVSIAAFSPRLDEHGHSVRGIDILERLSRDMG
LHLMEGTPSAQTIVQSHYRTGKDASLSVYVLRGVLKFTEAEMLLRILQDETTDQSTIVID
LTQISLIHDVGKRMFLEGVDRLIDDGHTLVLVDPEQRLDHARTAKDRELHVYHDFDDLLE
KHEIPAKKKTYSDIAALLNC
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccctctcccagattatttggcaaatgttatagaagcctgtgacatcgataac
agcggtcatctcgccgattatattcctgagttggcaaatgcaaacccaaatcgattagct
ttagcaatgtctacggtagatggtgaaatttattcggtcggcgatgatgatgttgaattc
accatacaatcgatttctaaaccttttgtgtatgcttatgttttacaacaacttggtatt
gatgcagttcttgcgaaagtaggggtagagccttcgggggaagccttcaatgaaatttca
ttgggtaaagatggtcgtccaaaaaatccgatgattaactctggtgcaattactgtacat
tccttgattcaggtcaaacatggtttgcatagtgcagaaattctacgacgttttatgagc
gagcttgctggtcgcgaattaagttttgatgagtctgtttatgattcggaagtcaaaaca
gcctaccgtaatctttcgatcggttatatgttgcgcacggtggggattttggaaactgac
cctgtcgatattgtgaatggttacattcgtcaatgtgcgatcatggttacagttaaagat
ttagtacgcatgggcagtgtacttgccaatggcggggtcgaccctaaaactggaaaacga
ttactgaaccgatctgtagttagacaagtactcagtgtcatgatgagctgtggtatgtat
gatgccgcgggtgactggctttcaactgtcggtattcctgctaaaagtggtgtagcaggc
ggtattttgggggtgttgccgggtcaagttagtattgctgctttttcacctcgactagat
gagcacggtcatagtgttcgaggaattgatattttagagcgattatctcgtgacatggga
ttacatctcatggaaggtacgccttctgcacaaacgattgtacaaagtcattaccgtact
gggaaagatgcatcgttaagtgtgtatgtgcttcgaggcgtattgaaatttaccgaagct
gaaatgttgttgcgtattttacaagacgagacaacggaccaaagcacaatcgtgattgat
ttaacccagatttcacttatccacgatgtgggtaaacgtatgttcttagaaggtgtagat
cgtctgattgatgatggccatactcttgttttagtcgatcctgaacaacgattagatcat
gcaagaacagctaaagatcgagaacttcatgtttatcatgatttcgatgatttgcttgaa
aagcatgagatccctgcaaaaaaaaagacttatagcgacatcgcagcacttctaaactgc
tga

DBGET integrated database retrieval system