KEGG   Acinetobacter baumannii TYTH-1: M3Q_1263Help
Entry
M3Q_1263          CDS       T02261                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00010  Glycolysis / Gluconeogenesis
abh00052  Galactose metabolism
abh01100  Metabolic pathways
abh01110  Biosynthesis of secondary metabolites
abh01120  Microbial metabolism in diverse environments
abh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M3Q_1263
   00052 Galactose metabolism
    M3Q_1263
Enzymes [BR:abh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     M3Q_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFU37355
Position
complement(1362088..1363233)
Genome map
AA seq 381 aa AA seqDB search
MKKLAILGVTVYSFAQLANAATLNVKPYGTTQDGQKVDLYTMSNNNGVSVSFISFGGVIT
QILTPDAQGKQNNIVLGFDDLKGYEVTDTKEGIHFGGLIGRYANRIGNAKFSLDGKTYNL
EKNNGPNSLHSGNPGFDKRVWQVKPLISKGETVKASLKLTSPNGDQGFPGKLDVEVIYSL
SDQNEFKIEYKAKTDQPTVVNLTNHSYFNLSGAGNNPYGVLDHVVQLNADRILVTDQNSL
PTGEIASVAGTPFDFRTPKAIVKDIRANNQQLAYGYGYDQTWVINQKSQGKLNLAAIVVD
PKSKRTMQVLTTEPSVQMYTANHLLGNIVGANGVLYRQADALALETQHFPDSPNQPAFPS
TRLNPNQTYNSVTVFKFGVQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagcaattttaggtgttacggtttatagctttgcacaactggcaaatgca
gcaacgttaaatgtaaaaccatatggtacgactcaagacggccaaaaagttgatctatac
accatgagtaataacaatggagtctcggtatcttttattagttttggtggtgtaattaca
caaatcttgactcccgatgcccaaggcaaacaaaataatattgttttgggctttgatgac
ctaaaaggctatgaagtcactgataccaaggaaggcattcattttggtggattaattggt
cgttatgcgaaccggattggtaatgctaaatttagcttagatgggaaaacgtataatctt
gaaaaaaataatggcccgaactcattacatagcggcaatcctggttttgataaacgtgtt
tggcaagttaaacccctcatttctaaaggtgaaactgttaaagcttctctgaagttaacc
agtccaaatggagatcaaggttttcctggaaaattagatgtagaagtgatttacagtctt
tcagatcaaaatgaattcaagattgaatataaagccaaaactgatcagcctacagtcgtc
aaccttaccaaccacagttatttcaacttatcaggcgctgggaacaatccttatggcgtg
ctagatcatgtggtacaactcaatgcagaccgtatattggtaactgatcaaaactcttta
ccaacaggtgaaattgcttcagttgcaggtacaccttttgattttcgaacgcctaaagca
atcgtaaaagatattcgagcaaataatcagcaattggcctatggatatggctatgaccaa
acttgggtaattaatcaaaagtctcaagggaaactcaatcttgcagctattgtggttgac
ccaaaatctaaacggaccatgcaagtcttaaccactgaaccaagtgtccaaatgtataca
gccaatcatttattaggaaatattgttggcgcaaatggcgtactctatcgacaagcagac
gcactagcattagaaacacagcattttccagacagcccgaatcaaccggctttcccgtct
acacgtttaaacccaaatcaaacttataacagtgttaccgtatttaagtttggtgttcaa
aaatag

DBGET integrated database retrieval system