KEGG   Acinetobacter baumannii TYTH-1: M3Q_1263Help
Entry
M3Q_1263          CDS       T02261                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M3Q_1263
   00052 Galactose metabolism
    M3Q_1263
Enzymes [BR:abh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     M3Q_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1362088..1363233)
Genome map
AA seq 381 aa AA seqDB search
MKKLAILGVTVYSFAQLANAATLNVKPYGTTQDGQKVDLYTMSNNNGVSVSFISFGGVIT
QILTPDAQGKQNNIVLGFDDLKGYEVTDTKEGIHFGGLIGRYANRIGNAKFSLDGKTYNL
EKNNGPNSLHSGNPGFDKRVWQVKPLISKGETVKASLKLTSPNGDQGFPGKLDVEVIYSL
SDQNEFKIEYKAKTDQPTVVNLTNHSYFNLSGAGNNPYGVLDHVVQLNADRILVTDQNSL
PTGEIASVAGTPFDFRTPKAIVKDIRANNQQLAYGYGYDQTWVINQKSQGKLNLAAIVVD
PKSKRTMQVLTTEPSVQMYTANHLLGNIVGANGVLYRQADALALETQHFPDSPNQPAFPS
TRLNPNQTYNSVTVFKFGVQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagcaattttaggtgttacggtttatagctttgcacaactggcaaatgca
gcaacgttaaatgtaaaaccatatggtacgactcaagacggccaaaaagttgatctatac
accatgagtaataacaatggagtctcggtatcttttattagttttggtggtgtaattaca
caaatcttgactcccgatgcccaaggcaaacaaaataatattgttttgggctttgatgac
ctaaaaggctatgaagtcactgataccaaggaaggcattcattttggtggattaattggt
cgttatgcgaaccggattggtaatgctaaatttagcttagatgggaaaacgtataatctt
gaaaaaaataatggcccgaactcattacatagcggcaatcctggttttgataaacgtgtt
tggcaagttaaacccctcatttctaaaggtgaaactgttaaagcttctctgaagttaacc
agtccaaatggagatcaaggttttcctggaaaattagatgtagaagtgatttacagtctt
tcagatcaaaatgaattcaagattgaatataaagccaaaactgatcagcctacagtcgtc
aaccttaccaaccacagttatttcaacttatcaggcgctgggaacaatccttatggcgtg
ctagatcatgtggtacaactcaatgcagaccgtatattggtaactgatcaaaactcttta
ccaacaggtgaaattgcttcagttgcaggtacaccttttgattttcgaacgcctaaagca
atcgtaaaagatattcgagcaaataatcagcaattggcctatggatatggctatgaccaa
acttgggtaattaatcaaaagtctcaagggaaactcaatcttgcagctattgtggttgac
ccaaaatctaaacggaccatgcaagtcttaaccactgaaccaagtgtccaaatgtataca
gccaatcatttattaggaaatattgttggcgcaaatggcgtactctatcgacaagcagac
gcactagcattagaaacacagcattttccagacagcccgaatcaaccggctttcccgtct
acacgtttaaacccaaatcaaacttataacagtgttaccgtatttaagtttggtgttcaa
aaatag

DBGET integrated database retrieval system