KEGG   Acinetobacter baumannii TYTH-1: M3Q_1283Help
Entry
M3Q_1283          CDS       T02261                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:abh01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1388424..1388984)
Genome map
AA seq 186 aa AA seqDB search
MFVSAKTILILGDSISAGYGIDPKQGWVQLLQKRLDQQYPKQHKVVNASVSGETTSGALA
RLPKLLQTYKPEVVVIELGGNDGLRGQPPQMIQKNLSQLIQLSQKQKAKVILFGMKIPPN
YGTAYSKAFENSYKTVSQKYQVKLLPFFLDGVAGQKQLMQNDLIHPNTQAQSKLLNLAYP
YIKGAL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtctcggcaaaaactattttaattttaggagatagtattagtgccggttatgga
atagaccctaaacaaggttgggtacaattactacaaaaacgtttagaccaacagtatccc
aaacaacataaagtggtcaatgcaagtgtgagtggggaaaccactagtggcgctttggca
cgattaccaaaacttttacaaacgtataaacccgaggtagttgttattgaattaggcggg
aatgatggcttacgtggtcaaccaccacaaatgattcaaaaaaatctgtctcagctcatt
caattaagccagaagcaaaaagccaaggttattctttttggtatgaagattccgcccaat
tatggcacggcttatagcaaagcattcgaaaatagctacaaaactgtaagtcaaaaatat
caggtgaaattgctaccgttttttcttgatggcgtcgctgggcaaaagcaactaatgcaa
aatgacttgattcatccaaatacccaagcacaatcaaaattactgaatttagcttaccca
tacataaaaggtgccctatag

DBGET integrated database retrieval system