KEGG   Acinetobacter baumannii TYTH-1: M3Q_1702Help
Entry
M3Q_1702          CDS       T02261                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00071  Fatty acid degradation
abh00280  Valine, leucine and isoleucine degradation
abh00281  Geraniol degradation
abh00310  Lysine degradation
abh00360  Phenylalanine metabolism
abh00362  Benzoate degradation
abh00380  Tryptophan metabolism
abh00410  beta-Alanine metabolism
abh00627  Aminobenzoate degradation
abh00640  Propanoate metabolism
abh00650  Butanoate metabolism
abh00903  Limonene and pinene degradation
abh00930  Caprolactam degradation
abh01100  Metabolic pathways
abh01110  Biosynthesis of secondary metabolites
abh01120  Microbial metabolism in diverse environments
abh01130  Biosynthesis of antibiotics
abh01212  Fatty acid metabolism
Module
abh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M3Q_1702
   00650 Butanoate metabolism
    M3Q_1702
  Lipid metabolism
   00071 Fatty acid degradation
    M3Q_1702
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M3Q_1702
   00310 Lysine degradation
    M3Q_1702
   00360 Phenylalanine metabolism
    M3Q_1702
   00380 Tryptophan metabolism
    M3Q_1702
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M3Q_1702
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    M3Q_1702
   00281 Geraniol degradation
    M3Q_1702
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M3Q_1702
   00627 Aminobenzoate degradation
    M3Q_1702
   00930 Caprolactam degradation
    M3Q_1702
Enzymes [BR:abh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     M3Q_1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFU37794
Position
1802287..1803060
Genome map
AA seq 257 aa AA seqDB search
MQELIKASTAADGVLLLTLNRPEKRNALNNATLQCLCELLEEAEHNAQVKAVVLTGNAQC
FAAGADLSELAAMDAVSLQLDIRPKLWQKIDAFSKPLITAVNGYALGAGFELVLHSDMVI
CGENARFALPEIGLGMLPGAGGTQRLARLVGQQLTMRWAMTGEMISAKQAEQHGICSQVV
PTELTVEYAVQLAAKIAKQAPLAIRVIKQSIKSIHETTLSQGLKFERQNFVWLAATKDRN
EGINAFFEKRKPVFRGE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagttgatcaaagccagtacagctgctgacggtgttttgttattaaccctaaac
cgtccagaaaaaagaaatgctttaaacaatgcaacattacagtgtttatgcgagttgctc
gaagaagctgaacataatgctcaagtcaaagcggtggttttaacgggtaacgctcagtgt
tttgcggctggagcagatctgagtgagttggctgcaatggacgccgtgtctttgcaactc
gatattcgcccgaagctttggcaaaaaattgatgcgtttagtaagccactgattacagca
gtgaatggctatgccttaggcgctgggtttgagttggttttgcattcagatatggtgatt
tgcggtgaaaatgcccgattcgctttacctgaaattggccttgggatgttgccgggtgca
ggcggaacacagcgtttagcacgcttggttggacaacaactcaccatgcgctgggctatg
acaggtgaaatgatttcggcaaaacaagccgagcaacatggcatttgcagtcaagtggtt
ccgaccgaattaaccgttgaatatgcggttcaacttgcagccaaaattgccaaacaagcg
cctttagcgattcgcgtgattaaacaatcaattaaaagtattcatgaaacaacattaagt
cagggactcaagtttgaacgtcaaaactttgtctggctggcggctacaaaagatcgaaac
gaagggattaatgctttctttgagaaaagaaagccagtgtttagaggtgagtga

DBGET integrated database retrieval system