KEGG   Acinetobacter baumannii TYTH-1: M3Q_1857Help
Entry
M3Q_1857          CDS       T02261                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    M3Q_1857
  Metabolism of other amino acids
   00480 Glutathione metabolism
    M3Q_1857
Enzymes [BR:abh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     M3Q_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975787..1976272
Genome map
AA seq 161 aa AA seqDB search
MSNIYQFEAELLEGDIKQFADYKGKVLLIVNTASKCGFTPQFAGLEKLYEKYKDQGLEVL
GFPCNQFGGQDPGSNKEIGTFCQRNYGVKFPMFAKVDVKGPEAHVIFRYLTREAKGILGS
STIKWNFTKFLVGKDGSVLNRYAPTTKPEALEADIEKALAS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacatttatcagtttgaagctgaattgttagagggagatattaaacaattcgct
gattacaaaggtaaagttttattaattgtaaatactgcaagtaaatgtggttttactcca
cagtttgcgggcctcgaaaaactttatgaaaaatataaagaccaaggtttagaagtttta
ggttttccctgcaatcagtttggtgggcaagatcccggaagcaataaagagataggtaca
ttctgccagcgtaactatggagtgaaattccctatgtttgccaaagtagatgtaaaaggt
cctgaagctcatgtgatctttagatatttaacccgtgaagcaaaaggaattttaggaagc
agtactattaaatggaactttaccaagtttttagtgggtaaagatggttcggttttaaat
cgttatgcgccaacaaccaagcctgaagcattggaagctgatattgaaaaagcattagcg
agttaa

DBGET integrated database retrieval system