KEGG   Acinetobacter baumannii TYTH-1: M3Q_2070Help
Entry
M3Q_2070          CDS       T02261                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    M3Q_2070
DNA repair and recombination proteins [BR:abh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      M3Q_2070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2188167..2188685
Genome map
AA seq 172 aa AA seqDB search
MALHLLMKNREGAFALAHALHEASSYIHECSVCHSLTEHEICDICASTERDDQLLCVVES
PADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEEIGIPYLIQRLSQGTIEEVILATNATV
EGQATAHYLVEATKHLPIHMTRIAQGVPQGGELEYVDSHTLSQAVHNRMRMK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctttacatcttttgatgaaaaatcgtgaaggtgcatttgctttagcacatgctcta
catgaagcatcaagttatattcatgaatgtagtgtttgccactctttaacagagcacgaa
atttgtgatatttgcgcttcaacagaaagagatgatcaattgctttgtgtagttgagtcc
ccggcagatgttatggcaatcgagcaaagtggtagttttcgtggcaaataccatgtgttg
ggtggacacctttctccattagatggaatcgggccagaagaaataggcattccttatcta
atccaacggttaagccaaggtacgatcgaagaagtcattttggcaactaatgctactgtg
gaaggtcaggcgacagcgcattatttggttgaagcgacgaagcatttacctattcacatg
acacgtattgcgcaaggcgtaccacaaggtggcgagcttgaatatgtggatagtcatacc
ttaagtcaggctgttcataaccgtatgcgtatgaaataa

DBGET integrated database retrieval system