KEGG   Acinetobacter baumannii TYTH-1: M3Q_2377Help
Entry
M3Q_2377          CDS       T02261                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    M3Q_2377
   00565 Ether lipid metabolism
    M3Q_2377
   00590 Arachidonic acid metabolism
    M3Q_2377
   00591 Linoleic acid metabolism
    M3Q_2377
   00592 alpha-Linolenic acid metabolism
    M3Q_2377
Enzymes [BR:abh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     M3Q_2377
    3.1.1.32  phospholipase A1
     M3Q_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2524827..2525978)
Genome map
AA seq 383 aa AA seqDB search
MAFRQFERTSLQLSMGTLLSCLCASVAYADTLAPVKPASVDACVALASNADRLACYDAVF
KPSALPVVQAAVVPEPVKKIDKPVVQPETFKEKVVDKVSNIKVIGKAPTLEPTTSLLDQR
WELSEKSKLGVWNIRAYQPVYLLPVFWTSDKNEFPSSPNPNNTVTEAQNLKSTESKFQIS
LKTKAWENIFGNNGDLWVGYTQSSRWQTFNAEESRPFRETNYEPEASLMFRTNYELLGLD
GRLLGVTLNHQSNGRSDPLSRSWNRVIFNVGLERGNFALMLRPWIRLEEDSKDDNNPDME
DYIGRGDLTAFYKWKQNDFSLMLRHSLKGGDDSHGAVQFDWAFPISGKLRGHFQLFNGYG
ESLIDYNHRATYAGLGVSLMNWY
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcagacaatttgaacgcacatctttacagctaagtatgggaaccctgcttagc
tgtttatgtgcgtcggtggcatatgccgacaccttagcccctgtaaaacctgcgagtgta
gatgcatgtgttgcccttgcttcgaatgctgatcgcctagcttgttatgatgctgtgttt
aaaccatcggccttaccagtagttcaagccgcagtagtaccagagcctgttaaaaaaatt
gataaacctgttgttcaacctgaaacatttaaagaaaaggttgtagataaggtaagtaat
atcaaagtaattggtaaggcacctacacttgaacctactacgtctttactagatcaacgt
tgggagttgtctgaaaaaagtaaactgggtgtttggaatattcgtgcttatcaacctgtt
tacttgctaccagttttctggacgagcgataaaaatgagtttccaagcagtccaaaccca
aataatacggtgacagaggcccaaaaccttaaatcaactgaaagtaaatttcagatttct
ttgaaaacgaaagcttgggaaaatatttttggtaacaatggtgacttgtgggtaggttat
acccaatcttcacgttggcagacctttaatgctgaagagtctcgtccattccgtgaaacg
aactatgagccagaagcaagtttaatgtttagaacaaactatgagttgcttggcttagat
ggtcgtttgcttggggtaactttaaatcaccagtcaaatggacgttcagatcctttatct
cgtagttggaaccgtgtcatctttaatgtgggtttagaacgcggtaactttgctttaatg
cttcgtccatggatacgccttgaagaagacagcaaagatgataacaatccagatatggaa
gattacatcggtcgtggtgatttaactgctttttataagtggaagcaaaatgacttctca
ttaatgctacgtcactctttaaaaggtggtgatgattctcatggtgctgttcagtttgac
tgggctttcccgattagtggcaagctgcgcggacacttccaattatttaatggttatggt
gaaagcttaattgactataaccatcgtgcaacttatgccggcttgggtgtttcactcatg
aactggtactaa

DBGET integrated database retrieval system