KEGG   Acinetobacter baumannii TYTH-1: M3Q_298Help
Entry
M3Q_298           CDS       T02261                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M3Q_298
   00052 Galactose metabolism
    M3Q_298
   00500 Starch and sucrose metabolism
    M3Q_298
   00520 Amino sugar and nucleotide sugar metabolism
    M3Q_298
Enzymes [BR:abh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     M3Q_298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322521..323396
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSVVSIRQPRPLGLGHAVLCAKSVV
GQDDFAVLLPDVLVKDSSGQNDLSRMISRYNSSQAAQIMVEAVPDHLVDQYGIVDVKHSP
NEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QDTDTVEAYRMQGQTFDCGSKIGYLKAVLHYGVEHPKLGNDFKQLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaagcagttttaccagtagccggtttaggtacacgttttctaccggcaagt
aagtctattccaaaggaaatggtaacggtcgttgatcgtcctgcaattgaatatgtagta
cgcgaggcggtagaggctggaattgaacaaattattttagtgactcattcatcgaaagca
tcaattgaaaattattttgatcgtaactttgagttggaaaccaccctagaacaaaagaaa
aaattcgatttacttgcagagattactcaaattgtgcctgagcatgtgagtgtagtaagt
ataagacaacctcggcctttaggcttagggcatgctgttttatgtgcaaagagtgttgtc
ggtcaagatgattttgctgtgctattaccagatgtattagtgaaagatagctctggacaa
aatgatctatctcgtatgatttctcgctataactcaagccaagctgctcaaatcatggtt
gaagcagtgccagaccatttagtagatcaatatgggattgtggatgtaaaacatagccca
aatgaaggtgaaagtattgctatgcagggtattgttgaaaagcccgcagtaggttctgca
ccatcaaacttatcggtggttggccgctatgtgttacctgccaagattatgcaattactt
gagaacacgccgaaaggtgcgggtaatgaaattcagttaactgatgcaattgcaatgctt
caagacacagatactgttgaagcttatcgtatgcaaggtcaaacgtttgattgtggtagt
aagattggctatttaaaagctgtactacactatggagttgaacaccctaagttaggaaat
gattttaaacagttaattcaggaacttaaattataa

DBGET integrated database retrieval system