KEGG   Acinetobacter baumannii TYTH-1: M3Q_3146Help
Entry
M3Q_3146          CDS       T02261                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:abh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3359709..3361217)
Genome map
AA seq 502 aa AA seqDB search
MSNCPKKYIVAFDQGTTSSRAIVLDHDANVVSIAQREFTQIYPQPGWVEHDPMEIWATQS
AVWVEALAQAGIKSEQVAAIGITNQRETTIVWDKKTGRPIYNAIVWQSRQTTEICNQLYK
AGWQEYIRKTTGLVIDPYFSATKIKWILDHVEGSRERAERGELLFGTVDTWLIWKLTNGA
VHVTDFTNASRTMLFDIEKLEWDEKLLQALDIPRAMLPEVRSSSEVYGYTHTISGQEVGI
PIAGIAGDQQAALFGQMCVESGQAKNTYGTGCFLLMNTGKKIVRSEHGLLTTIACGASGE
VNYALEGAVFNGGSCVQWLRDELKVIKNAKDSELYATRVKDNNGVYVVPAFTGLGAPYWD
PTARGAIFGLTRGASIEHIIRATLESIAFQTRDVLDAMQQDAEEELRTLRVDGGVTENNF
LMQFQADILATPVERPIMKETTALGAAFLAGLATGFWQDLHELRNKSAIEKVFEPKMSSE
QSEMIYKGWLKAVKRSQSWAED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattgcccgaaaaaatatattgtcgcttttgatcagggaacaacaagctcaaga
gcaattgttttagatcatgatgcgaacgttgtcagtattgctcaaagagaatttacccag
atttaccctcagccaggttgggttgagcatgatcctatggaaatttgggcaactcaaagt
gctgtatgggtcgaagcattggctcaagctggcatcaagagtgaacaagttgcggcaatt
ggaattacaaaccaacgggaaaccactattgtctgggacaaaaaaacaggaagacctatt
tacaatgcgattgtttggcaaagccgacaaacaacggaaatatgcaatcaattgtataaa
gcaggttggcaagaatatatccgtaagaccactggtttagtcattgatccatatttctcg
gccacaaaaattaaatggattttggatcatgttgaaggcagccgtgagcgtgctgaacga
ggagagctattattcggtacggtggacacttggctgatttggaaactaactaatggggcc
gtccatgtcactgattttaccaatgcatctcgaaccatgctgtttgatatcgaaaagctt
gagtgggatgaaaagcttttacaagctttagacattcctagagcaatgttgccggaggtt
cgtagttcatctgaggtttatggatatacacataccattagtggacaagaagtaggaatc
ccaattgccggaatcgcgggtgatcagcaggctgcgctttttggtcaaatgtgtgttgag
tcgggacaggctaaaaatacctacggtactggctgttttctactcatgaatacgggtaaa
aagattgtccgttcagagcatggattactcacaactattgcctgtggtgcgagtggtgag
gtgaactatgccttagagggtgccgtatttaacggtggttcttgcgtacagtggttacgt
gatgaattaaaggttattaagaatgctaaggattccgagctttatgcaacacgtgtaaag
gataataatggtgtatatgtagtacctgcttttaccgggttaggagcaccgtattgggac
ccgacagctcgcggcgcaatttttggtctgacgcgtggggctagtattgaacatattatc
cgcgcaactctagagtctatagcctttcaaactcgggatgttttagatgccatgcaacaa
gatgcagaagaagagcttcgtacactccgtgtcgatggaggagtaacggaaaataatttc
ttaatgcaatttcaggctgatattttagcgacaccagtagaacgtccaataatgaaagaa
actactgctttgggtgcagctttccttgctgggctggcgacgggtttctggcaagatcta
catgagttaagaaataaatctgccatagaaaaggtatttgagccaaaaatgtcttctgag
caatctgagatgatttataagggttggctcaaggcagttaaacgtagtcaaagttgggct
gaggattag

DBGET integrated database retrieval system