KEGG   Acinetobacter baumannii TYTH-1: M3Q_3154Help
Entry
M3Q_3154          CDS       T02261                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3368583..3369434)
Genome map
AA seq 283 aa AA seqDB search
MQLISLPKQILQCGQLQLDLSQPHVMGILNVTPDSFSDGGKHNQLDQAVDHALSMIEQGA
TIIDIGGESTRPGASEVVVEEEVRRVVPVVEALSHHNVILSIDTSQPEVIRAAKAAGAHI
WNDVRALTRPNALKTAVELDIPVVIMHMRGEPTTMNQLDQYTDVTLDVMQELQQRIDEAL
AAGVKKHNIIVDPGFGFAKNAQQNLKLLKEFWKLNELGYPILSGLSRKRFIGEALQGAPA
DQRAVGSVTGHLLSIQQGASIVRAHDVKEMHEAILVWKAMQQV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaatatctttaccaaagcagattttacagtgtggacagcttcaattagattta
tctcagccccatgttatgggtatcttaaatgtcactcctgattctttcagtgatggtggt
aaacataaccaattagaccaagcggttgatcatgcacttagtatgattgagcaaggcgcg
actattattgatattgggggggaatctacccgacctggtgcttcagaagttgtagtagaa
gaagaagtgcgtcgtgtggtacctgtggtcgaggctttatctcaccataacgttattttg
tcgatcgacacaagtcagccagaagttattcgcgcagcaaaagcagcaggggcacatatc
tggaatgatgtccgtgccttaacacgtcccaatgctttaaaaactgccgtagaattagat
atacctgtagtaattatgcatatgcgcggtgaaccaacgacaatgaatcagttggatcag
tacactgatgtaacactcgatgtgatgcaagagttgcaacagcgtattgatgaggctttg
gctgctggggtaaaaaagcacaatattattgttgatcctggatttggctttgcgaaaaat
gcccagcaaaatttaaaactattaaaagaattttggaaacttaatgaacttggttatcca
attttatccgggctttctcgtaaacgtttcataggtgaagctttacaaggcgctcctgca
gatcaacgtgctgtgggaagtgtaactgggcatttgcttagtattcagcagggagcatcc
attgtaagagcgcatgatgtaaaggaaatgcatgaagcaattttagtttggaaagcgatg
cagcaagtctga

DBGET integrated database retrieval system