KEGG   Acinetobacter baumannii TYTH-1: M3Q_3360Help
Entry
M3Q_3360          CDS       T02261                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M3Q_3360
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M3Q_3360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M3Q_3360
Enzymes [BR:abh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M3Q_3360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3600620..3601753)
Genome map
AA seq 377 aa AA seqDB search
MAALEDLENLYSRMKNDEQFLAEFDRDLAYYVGRPSPLYYAERWSKELGGAQIYLKREDL
NHTGSHKVNNTIGQALLAKLSGKKRIIAETGAGQHGVATATIAARLGLECVVYMGAEDVK
RQAMNVYRMRLLGATVVPVQSGSKTLKDAMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQL
VRDFQSIIGREARKQILEQAGRLPDALVACVGGGSNAMGLFYPFLNDASVKMYGVEAAGF
GIETGKHSAPLNAGHVGVLHGNRTYLMSDEQGQIIETHSISAGLDYPGVGPEHSFLKDMK
RVEYVPINDTEALQGFRDLTKIEGIIPALESSHAMAYVSKLAPTMSKDQIIIATVSGRGD
KDLMTVARIDGVEMVEM
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattagaagatttggaaaatctctattcccgcatgaaaaatgatgaacagttt
ttggcagaattcgaccgtgatctcgcctactatgtaggtcgtcctagtccactttattat
gctgagcgatggtcaaaagagttaggtggtgcgcaaatttaccttaaacgtgaagacttg
aaccatacaggctcacacaaggtaaacaacacgattggtcaggcactacttgcaaagctt
tctggtaaaaaacgtattattgccgaaactggtgcaggccagcatggggtagcaacagca
acaattgcagcacgtttaggtcttgaatgtgttgtttatatgggtgctgaagacgttaag
cgtcaagcgatgaacgtttaccgtatgcgtttgttaggtgcaacagttgtgcctgtgcaa
agtggctctaaaacattaaaagatgccatgaacgaagcgatgcgtgactgggtaaccaac
gttgatacaacatattatgtcattggtacagttgcaggtccgcatccttatcctcaactt
gttcgtgacttccaatcaattattggtcgtgaagcgcgtaaacagattttggaacaagca
ggtcgcttaccagatgcattagttgcttgtgtaggtggtggttcaaatgcaatgggcttg
ttttatccgttcttaaacgatgccagtgtaaaaatgtatggggttgaagctgctggtttt
ggtattgaaactggtaaacactctgcgcctttaaatgcgggtcatgtgggtgtattacat
ggtaaccgtacttatttaatgagtgatgaacagggccagattattgagacacacagtatc
tcggcgggccttgattatccgggtgttggtcctgaacatagtttcttgaaagatatgaag
cgtgtagagtacgtgccgattaatgatacagaggctcttcaaggtttccgtgacttaacc
aaaatcgaagggattattcctgcgcttgaaagctcgcacgcgatggcgtatgtctctaag
cttgcaccgacgatgtctaaagatcagattattattgcgactgtttcaggccgtggcgat
aaagacttaatgacagttgcacgcattgatggcgtagaaatggtcgagatgtaa

DBGET integrated database retrieval system