KEGG   Acinetobacter baumannii TYTH-1: M3Q_3360Help
Entry
M3Q_3360          CDS       T02261                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00260  Glycine, serine and threonine metabolism
abh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abh01100  Metabolic pathways
abh01110  Biosynthesis of secondary metabolites
abh01130  Biosynthesis of antibiotics
abh01230  Biosynthesis of amino acids
Module
abh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M3Q_3360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M3Q_3360
Enzymes [BR:abh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M3Q_3360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFU39445
Position
complement(3600620..3601753)
Genome map
AA seq 377 aa AA seqDB search
MAALEDLENLYSRMKNDEQFLAEFDRDLAYYVGRPSPLYYAERWSKELGGAQIYLKREDL
NHTGSHKVNNTIGQALLAKLSGKKRIIAETGAGQHGVATATIAARLGLECVVYMGAEDVK
RQAMNVYRMRLLGATVVPVQSGSKTLKDAMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQL
VRDFQSIIGREARKQILEQAGRLPDALVACVGGGSNAMGLFYPFLNDASVKMYGVEAAGF
GIETGKHSAPLNAGHVGVLHGNRTYLMSDEQGQIIETHSISAGLDYPGVGPEHSFLKDMK
RVEYVPINDTEALQGFRDLTKIEGIIPALESSHAMAYVSKLAPTMSKDQIIIATVSGRGD
KDLMTVARIDGVEMVEM
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattagaagatttggaaaatctctattcccgcatgaaaaatgatgaacagttt
ttggcagaattcgaccgtgatctcgcctactatgtaggtcgtcctagtccactttattat
gctgagcgatggtcaaaagagttaggtggtgcgcaaatttaccttaaacgtgaagacttg
aaccatacaggctcacacaaggtaaacaacacgattggtcaggcactacttgcaaagctt
tctggtaaaaaacgtattattgccgaaactggtgcaggccagcatggggtagcaacagca
acaattgcagcacgtttaggtcttgaatgtgttgtttatatgggtgctgaagacgttaag
cgtcaagcgatgaacgtttaccgtatgcgtttgttaggtgcaacagttgtgcctgtgcaa
agtggctctaaaacattaaaagatgccatgaacgaagcgatgcgtgactgggtaaccaac
gttgatacaacatattatgtcattggtacagttgcaggtccgcatccttatcctcaactt
gttcgtgacttccaatcaattattggtcgtgaagcgcgtaaacagattttggaacaagca
ggtcgcttaccagatgcattagttgcttgtgtaggtggtggttcaaatgcaatgggcttg
ttttatccgttcttaaacgatgccagtgtaaaaatgtatggggttgaagctgctggtttt
ggtattgaaactggtaaacactctgcgcctttaaatgcgggtcatgtgggtgtattacat
ggtaaccgtacttatttaatgagtgatgaacagggccagattattgagacacacagtatc
tcggcgggccttgattatccgggtgttggtcctgaacatagtttcttgaaagatatgaag
cgtgtagagtacgtgccgattaatgatacagaggctcttcaaggtttccgtgacttaacc
aaaatcgaagggattattcctgcgcttgaaagctcgcacgcgatggcgtatgtctctaag
cttgcaccgacgatgtctaaagatcagattattattgcgactgtttcaggccgtggcgat
aaagacttaatgacagttgcacgcattgatggcgtagaaatggtcgagatgtaa

DBGET integrated database retrieval system