KEGG   Acinetobacter baumannii TYTH-1: M3Q_420Help
Entry
M3Q_420           CDS       T02261                                 

Definition
bifunctional pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    M3Q_420
Enzymes [BR:abh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     M3Q_420
    3.5.1.-  
     M3Q_420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455386..456030
Genome map
AA seq 214 aa AA seqDB search
MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNH
ISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHI
DSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDA
CKGIDLNGSLEQAWQTMQQQGVIRIQSTDLLNEC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaataaacaaccacaaaattcggctttagtcgtagttgacgtgcaaaatggt
tttacccctggtggaaacctagcagttgccgacgccgatacgattattccaaccattaac
caattggcaggttgttttgaaaatgtagtcctcactcaagactggcatccggataatcat
atttcttttgcagccaaccatccgggcaagcagccatttgaaacgattgaactggattat
ggatcacaggtgctttggcctaagcattgtatacaaggcactcatgatgccgaatttcat
ccggatttaaatatcccgacagctcaactgattatccgaaaaggttttcatgctcatatt
gatagttactcggcttttatggaagctgaccacaccacaatgacaggtttaacgggatat
ttaaaagaacgtggtattgatacggtctatgtggttggaattgctacagacttttgtgtc
gcatggactgctttagatgcggttaagcaaggctttaaaactttagtaattgaagatgcg
tgcaaaggtattgatcttaatggttcattagaacaagcgtggcaaactatgcagcaacaa
ggtgttatccgtattcaatcgactgatctgttgaatgaatgctag

DBGET integrated database retrieval system