KEGG   Acinetobacter baumannii TYTH-1: M3Q_439Help
Entry
M3Q_439           CDS       T02261                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    M3Q_439
Enzymes [BR:abh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     M3Q_439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(472559..473335)
Genome map
AA seq 258 aa AA seqDB search
MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDHGHDAGLAGQITCRSEN
KETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANRFHTWIYKEHPEVNCIIHT
HPTYVAALSMLQIPLMISQMDVCALYEDCSFVGHWPGVPVGNEEGILISSALGKNRAVLL
SHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIPHALAAEAHDWVSTDKRNK
VNFAYYARKALKKHSDCI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcttctgtaaacaaacacgacttgatgcaacacgcacagcaagacatgcaa
aagtggattagcgacttagatttaacagaccgtcaaaagcttgcactgacttgccgtatt
ttatttgatcatgggcatgacgctggtttagcgggtcaaattacatgccgtagtgaaaat
aaagaaacctttattactcaacgtttcggtttaggttttgatgaaattactgcttcaaac
ttgcttgaggtgaatcaggacttagaacccatcaatcaagaaggcatggcaaacccagcc
aaccgtttccacacatggatttataaagaacacccagaggtgaactgtattatccatacg
catcctacctatgtagcggccctgtcgatgctacagattccacttatgatttcccaaatg
gacgtctgcgcactttacgaagattgctcatttgtaggccattggccgggtgttcctgta
ggcaacgaagaaggtattttgatttcttctgctctgggtaaaaaccgcgctgttttgttg
tctcaccacggtcaactggtcacaggaaaaactatcgaagaagcctgtaacttggctctt
ttaattgaacgcgcagctcaactgcaacttttagccatgtctgccggacaaatccagcct
atcccccacgctttggcagcagaagcccatgattgggtgtctactgataaacgcaacaaa
gtgaactttgcttactacgcacgtaaagctttgaaaaaacattctgactgtatttaa

DBGET integrated database retrieval system