KEGG   Acinetobacter baumannii TYTH-1: M3Q_504Help
Entry
M3Q_504           CDS       T02261                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00260  Glycine, serine and threonine metabolism
abh00750  Vitamin B6 metabolism
abh01100  Metabolic pathways
abh01110  Biosynthesis of secondary metabolites
abh01120  Microbial metabolism in diverse environments
abh01230  Biosynthesis of amino acids
Module
abh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M3Q_504
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    M3Q_504
Enzymes [BR:abh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     M3Q_504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AFU36598
Position
complement(536719..537405)
Genome map
AA seq 228 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVVYDAATEPG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacacccctctcattaaacttgag
aatattccacgtattattggcaaagacgttgaaatttatgtgaaatacgagggcttaaac
ccgactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcagttgaagaa
ggctctaaagcaattatctgtgcatctacaggtaacacttctgctgctgctgctgcctat
gctgcacgcgcaggtatcaaagcgtttgttttgattccggaaggcaaaattgcgatgggt
aaaatggcgcaagccatgatgtatggtgcgatcactatgcaaattcgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagtggctgatcaagcacctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaaaactattgcttatgaaatcgttgaagcttta
ggccgtgcacctgattaccactgcttaccagttggtaacgcaggtaacattacagctcac
tggatgggttataccgaagcagtagctaaccagcctgctgaccaatttgaacaagttgtt
tatgacgctgcgactgaacccggataa

DBGET integrated database retrieval system