KEGG   Acinetobacter baumannii TYTH-1: M3Q_506Help
Entry
M3Q_506           CDS       T02261                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abh  Acinetobacter baumannii TYTH-1
Brite
Enzymes [BR:abh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     M3Q_506
Secretion system [BR:abh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   M3Q_506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(539007..539822)
Genome map
AA seq 271 aa AA seqDB search
MSFTRSQIFLACALASSLLFSACSKENKPQKEDALTATAPATGEASTIIERNAKQRLIET
LQKQFKNANINVKILDIKPTEVPNLYWVNLEGMTSVYTTSDGKYLIQGDVIRLGDKELHN
IGDSLQASENKKHLAALKNEDLIVYPAKGGKAKHVIYVFTDASCPYCHKLHEHLAEINEK
GIEVRYIAWPRGEQFMPTMEAVWCSADRKAAFDQAVQGISIPPAQCKNPVREQYQLGLNM
GVNGTPAIYNVDGEYLGGYLTPDELIKRLDK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttacccgatctcaaatttttcttgcctgtgctttggcttctagcctgttgttc
agtgcttgttctaaagaaaacaaaccacaaaaagaagatgcgctcacagcgaccgcacct
gctacaggggaagcttcaaccattattgaacgcaatgctaaacagcgtttaattgaaact
ttgcaaaaacaatttaagaatgcaaacatcaacgtcaaaattttagatattaagcctacc
gaagtgcctaatttatattgggttaaccttgaaggaatgacgtcggtttatacaacaagt
gatggtaaatacctgattcaaggtgatgtcatccgtttaggtgataaagaacttcataat
atcggcgatagccttcaagcctcagaaaacaaaaagcatcttgctgctttaaaaaatgaa
gacttaattgtttatccagctaaaggcggtaaagctaaacatgtgatttatgtgtttacc
gatgcaagctgtccttactgccataaattacatgagcatttagctgagattaatgagaaa
ggcattgaggttcgttacattgcatggccacgcggcgaacagtttatgccaactatggaa
gcggtttggtgtagtgcagaccgtaaagctgcatttgaccaagctgtacagggcattagt
attccacctgctcaatgtaaaaaccctgttcgcgaacaataccaacttggtctaaacatg
ggcgtaaatggtacaccagctatttataatgttgatggtgagtacttgggtggctactta
acaccggatgaattgattaaacgattggataaataa

DBGET integrated database retrieval system