KEGG   Acinetobacter baumannii TYTH-1: M3Q_528Help
Entry
M3Q_528           CDS       T02261                                 

Definition
hemD
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M3Q_528
Enzymes [BR:abh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     M3Q_528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
561439..562206
Genome map
AA seq 255 aa AA seqDB search
MLFINTRPDSRAAELTHALQNKGFQVESLPLLELVAQPFSESLSQLYQQLTGAQAIVVVS
PTAVDVGMQYLTQSGLKIDELKHIQWIAVGQATANRLHDYGIEAHVPEVETSEGMLNLPL
LHHMQKSGSVAFWRGEGGRQFMMETLQQQGIQILNFVLYRRQCPQASYSTFKHLTQNSNY
NLDKWLVLITSEASWKYWLELCLKNKAQPDCVYLVLGPRLFQLVKDYRDQQQAHFHIIQL
ENLSPSGMIHHIQAL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttattaatacccgacctgactcgcgtgcggctgaattaactcatgctttgcag
aataaggggtttcaggtcgagtctttacctcttttagaactggttgctcaacctttttca
gaatcactctctcaactctatcagcagttaactggcgcacaagcgattgtagtggttagt
cccactgctgttgatgtggggatgcagtatttaacacaaagtggtttaaaaatagatgag
ctaaaacatattcaatggattgcggtggggcaggcgacggctaatcgtcttcacgactat
gggattgaagcgcatgttcctgaggttgaaacttccgagggaatgcttaacttgcctctt
cttcatcatatgcaaaaatcaggtagtgtggctttttggagaggggaaggcggccgtcaa
tttatgatggaaactttgcaacagcaaggaattcagattttaaattttgttctatatcgc
cggcagtgtccgcaagcttcatattcgacattcaaacatctgacacagaattcaaattat
aatttagataaatggctcgtcttaattaccagtgaggcgagctggaaatactggttagag
ctttgtttaaaaaataaggcacaacctgattgcgtatatttagttttaggaccacgcctt
tttcaacttgttaaagactatcgcgatcagcaacaagctcattttcacattattcaactt
gaaaatttatcgccttcggggatgattcatcacattcaggcattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system