KEGG   Acinetobacter baumannii TYTH-1: M3Q_566Help
Entry
M3Q_566           CDS       T02261                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00071  Fatty acid degradation
abh00280  Valine, leucine and isoleucine degradation
abh00281  Geraniol degradation
abh00310  Lysine degradation
abh00362  Benzoate degradation
abh00380  Tryptophan metabolism
abh00410  beta-Alanine metabolism
abh00640  Propanoate metabolism
abh00650  Butanoate metabolism
abh00903  Limonene and pinene degradation
abh00930  Caprolactam degradation
abh01040  Biosynthesis of unsaturated fatty acids
abh01100  Metabolic pathways
abh01110  Biosynthesis of secondary metabolites
abh01120  Microbial metabolism in diverse environments
abh01130  Biosynthesis of antibiotics
abh01200  Carbon metabolism
abh01212  Fatty acid metabolism
Module
abh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M3Q_566
   00650 Butanoate metabolism
    M3Q_566
  Lipid metabolism
   00071 Fatty acid degradation
    M3Q_566
   01040 Biosynthesis of unsaturated fatty acids
    M3Q_566
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M3Q_566
   00310 Lysine degradation
    M3Q_566
   00380 Tryptophan metabolism
    M3Q_566
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M3Q_566
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    M3Q_566
   00281 Geraniol degradation
    M3Q_566
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M3Q_566
   00930 Caprolactam degradation
    M3Q_566
Enzymes [BR:abh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     M3Q_566
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     M3Q_566
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     M3Q_566
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     M3Q_566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AFU36659
Position
complement(602428..604581)
Genome map
AA seq 717 aa AA seqDB search
MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFE
MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
VKKASKQHEKGAHPVNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEANN
LLTKQVERKKMKPAQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKNV
RENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATTV
VLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSKFGWPMGPAY
LIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKKGK
KAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETVRCLEDNIVATASEADMAM
IMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgctggcaatgccattaccgtccaaatgcttgcggacggaattgcagaattc
cgctttgacttacaaggtgagtcggtcaataaattcaaccgtgcaacaattgaagatttc
aaagctgctatcgcggctgtaaaagctaataacgatattaaaggcttagttgttacctcg
ggcaaatctacattcattgttggtgcagatattaccgaatttggtcaaaactttgcacaa
ggcgaaaaagcgattgttgactggcttatgcctgttcacgaaatcttcaatagctttgaa
gatttagaccttccaaaagttgctgctattaacggcatggctttgggtggtggttttgaa
atgtgtttagtttgtgactatcgcgtgatgtcagaagctgcacaagtcggtttaccagaa
atcaaactcggtatttaccctggtttcggtggtagtgttcgtttaagccgtctcattggt
attgataatgcagttgaatggatggcaatggctactccaaagaaaccggctgctgcactt
aaagatggcgctgtagatgctgtggttgctgcggacaaattacttgacgctgctactgat
ctggttaagcaagcgatttctggtcgtttaaactggaaagcaaaacgccaagaaaaactt
gaagctgtaaaattgaacccacttgaacaaatgatggcgttcaacacagcaaaaggtgcg
gtacttgctaaagcaaatcctgctcaataccctgctccaaaattattacttgattcatta
caagctggtgcaagccttgcacgtgatgaagcgttaaaagctgaggctgaaggctttgcc
aaagcagccgtaactcctcaagctgaagcattaattggtttattcattaatgaccaagtt
gttaaaaaagcatctaagcaacatgaaaagggtgctcatcctgtaaaccaagctgctgta
cttggcgcgggtatcatgggtggtggtattgcttaccaagcggcaagcaaaggcactcca
atcatcatgaaagatattggtaacccacaacttgcattaggtatgaaagaagcaaacaac
ttgttaaccaagcaagttgaacgcaagaaaatgaaacctgcgcaaatgggtgaaacactt
gctcgcatccgtcctactttaagctacgaagagtttaaagaagtcgacatcgtgatcgaa
gcggtaactgaaaatccaaaagtaaaagaaatcgtacttgctgaaactgagaaaaatgtt
cgtgaaaacacgatcattgcttctaacacctctaccatttcaattacacgtttagcaaaa
gcattacaacgtcctgaaaacttcgttggtatgcacttcttcaacccagttcacatgatg
ccacttgttgaagttattcgtggtgagaaaacttctgaagaagcaattgcaactacggtc
gttcttgctcaaaaaatgggtaaaacaccaatcgttgtaaatgactgcccaggattcttg
gttaaccgtgtattgttcccttacttcggagcatttgaccttcttgtaaaagacggcgca
gatttccagcaaatcgacaatgtaatgtctaagttcggttggccaatgggtcctgcttat
ctgatcgatgttgtaggtatcgatacaggtgtacatggtgctgaagtgatggctgaaggt
ttccctgaccgtatgaagccagattacaaaggcgcgatcgaagcaatgtacgaagcgaag
cgtcttggtcaaaagaatgatgtaggtttctacaaatacgaactcgacaagaaaggcaag
aaagcaaaaactgttgatccaacagcgtatgaagtaattgctccattcgtaactggcgaa
aaacgcgaatttgataaccaagaaattattgaccgtatgatgcttgctctttgcaatgaa
actgttcgttgcttagaagacaacattgtagcgactgcgtctgaggcagacatggcaatg
attatgggtattggtttccctccattccgtggtggtccatgccgttacatcgaccaaaca
ggtgttgctgaatacgttgcactttgcgacaaatatgcgcacttaggtaaggcttatgaa
gcgccacaaatgttgcgcgacatggctgctaacaacaaaaaattctacggttaa

DBGET integrated database retrieval system