KEGG   Acinetobacter baumannii TYTH-1: M3Q_590Help
Entry
M3Q_590           CDS       T02261                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M3Q_590
   01230 Biosynthesis of amino acids
    M3Q_590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M3Q_590
   00051 Fructose and mannose metabolism
    M3Q_590
   00562 Inositol phosphate metabolism
    M3Q_590
Enzymes [BR:abh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     M3Q_590
Exosome [BR:abh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   M3Q_590
  Exosomal proteins of bladder cancer cells
   M3Q_590
  Exosomal proteins of melanoma cells
   M3Q_590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
628588..629382
Genome map
AA seq 264 aa AA seqDB search
MSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENCHVGVAPVSIALTTVQA
QLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNVEIL
KAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICDIAPVVTAEQWQNQVVIAYEP
IWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSNIAILYGGSVKAENAVELAACPDING
ALVGGASLNAASFYQIVQAFAQSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgacgattacgccttgggtagttggtaactggaaaatgaatccaatgcgt
gccaacgccaaccaacttatagaagaatttaaacaattattgcaacaaaaccaaattgca
gatgaaaactgccatgtgggcgttgcccctgtttctattgctcttacaacggtacaagcg
caattacaggatgctgcaagaacggtatatacggttgcacaggatgtatcacgtgttgct
ggtacaggtgcttatactggtgaagtcagtgcagaactattaaaagatagccaaattaat
ttcgtacttgtaggacactctgaacgtcgtgatatttttggtgacaacgttgaaattttg
aaggcaaaactccaaaatgcattaaatgcgggtatgactgtcatttattgtgtgggcgaa
agccttgaacaacgtgagcaaggtcaggccgagcaagttgttctacagcaaatttgtgat
attgcacctgtagttactgcagaacaatggcaaaaccaagtggttattgcctatgaacct
atttgggcaattggtacaggtaaaacagcttctccgcaagatgcgcaagcgatgcacgct
aaaattcgtgaaggcttatgccaacttacaccagcaggctcaaatattgctattttatat
ggcggtagtgtaaaagctgaaaatgctgttgagttagctgcatgtccagatatcaatggt
gcgttggtgggtggtgcttcattaaatgcagcatctttttatcaaattgtacaagccttc
gcgcaaagcaaataa

DBGET integrated database retrieval system