KEGG   Acinetobacter baumannii TYTH-1: M3Q_590Help
Entry
M3Q_590           CDS       T02261                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:abh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:abh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:abh00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:abh00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:abh00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628588..629382
Genome map
AA seq 264 aa AA seqDB search
MSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENCHVGVAPVSIALTTVQA
QLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNVEIL
KAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICDIAPVVTAEQWQNQVVIAYEP
IWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSNIAILYGGSVKAENAVELAACPDING
ALVGGASLNAASFYQIVQAFAQSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgacgattacgccttgggtagttggtaactggaaaatgaatccaatgcgt
gccaacgccaaccaacttatagaagaatttaaacaattattgcaacaaaaccaaattgca
gatgaaaactgccatgtgggcgttgcccctgtttctattgctcttacaacggtacaagcg
caattacaggatgctgcaagaacggtatatacggttgcacaggatgtatcacgtgttgct
ggtacaggtgcttatactggtgaagtcagtgcagaactattaaaagatagccaaattaat
ttcgtacttgtaggacactctgaacgtcgtgatatttttggtgacaacgttgaaattttg
aaggcaaaactccaaaatgcattaaatgcgggtatgactgtcatttattgtgtgggcgaa
agccttgaacaacgtgagcaaggtcaggccgagcaagttgttctacagcaaatttgtgat
attgcacctgtagttactgcagaacaatggcaaaaccaagtggttattgcctatgaacct
atttgggcaattggtacaggtaaaacagcttctccgcaagatgcgcaagcgatgcacgct
aaaattcgtgaaggcttatgccaacttacaccagcaggctcaaatattgctattttatat
ggcggtagtgtaaaagctgaaaatgctgttgagttagctgcatgtccagatatcaatggt
gcgttggtgggtggtgcttcattaaatgcagcatctttttatcaaattgtacaagccttc
gcgcaaagcaaataa

DBGET integrated database retrieval system