KEGG   Acinetobacter baumannii TYTH-1: M3Q_614Help
Entry
M3Q_614           CDS       T02261                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    M3Q_614
Enzymes [BR:abh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     M3Q_614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
661712..663061
Genome map
AA seq 449 aa AA seqDB search
MVTRQSLSIITGGPGTGKTYTLARIIAVLSQAIPHIRVAMAAPTGKAAQRMQEALQNSFN
DPKLLESGLISAELRNQSTQTIHRLLGMGHSQTPRFNQKQPLPYDVIVVDEASMLDLNLA
TLLFEAVPESCRIILLGDANQLASVDVGAVLADLQQIEALSENRVHLQTSRRFAEGALIG
QVARFIQMQTSQINHEQILQKFEIDIVQVSELRSIPLETDMPDVVQLEYLPEESPIALET
YYQKLMVDFQGYVQSLKAYIQDDRSLEHIENIVRSFDDYRILTAVRHGPFGLQQLNQYAE
RWLQQQLGIVTLGGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQPQQFEVYFPSLNKW
VAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELIYTAITRAKKVVSLL
VDPEALLQSFTVRTTRKSGLVEKVNRLVR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggtgactcggcagagcttaagtattattacaggtgggccgggtacaggtaagacctat
acgctcgctcgtattattgctgtgcttagtcaggcaattccacatattcgtgtagcgatg
gctgctccgacgggtaaagctgcacagcgtatgcaagaagccttacaaaactcctttaat
gacccaaaactgcttgagtcggggttaataagtgctgagctaagaaaccaaagtacccaa
actatccatcgattattaggtatggggcatagtcaaactccacggtttaatcaaaaacag
cctttgccttatgacgttattgtggtggatgaagcctctatgctggacttaaatctggca
acgttattatttgaagcggttcctgagtcttgtcgaattattttattaggtgatgccaac
cagcttgcttccgtagacgtcggagctgtacttgcagatttacagcaaatcgaggctttg
tctgaaaaccgtgttcaccttcaaaccagccgtcgttttgcggaaggggctttgattggt
caggttgcccgatttattcaaatgcaaaccagtcaaatcaaccatgagcaaattttacaa
aaatttgaaatcgatattgttcaggtttcagagttacgttcaatacctttagaaaccgac
atgcccgatgtggttcagcttgaatatttacccgaagagtcacctatagcgctagaaact
tactaccaaaaattgatggtggattttcaaggctatgtgcaaagcttaaaagcttatata
caagatgatcgttcacttgaacatattgaaaatatcgttaggtcattcgatgactaccgt
attttaactgccgtacgtcatggaccatttggtttacagcaacttaatcaatatgctgaa
cgctggttacaacaacagctaggtattgtgactttaggaggatggtatgttggccgtccg
gttatgatgacctataacgattaccagctcggtatttcaaatggtgacattggtttatgt
tttgaacatagaacccagccgcaacagtttgaagtgtattttccaagtttaaataagtgg
gttgctgcaaatcggctacctaaaagtattcaaagtgcatttgccttaacaattcacaaa
tcacaaggttctgaatttacccatacagctgttgttcttgatcaggctgccaagaatttg
ttaagccaagagttgatctacactgcgattacacgagccaaaaaagtagtgagtttattg
gtcgatccagaggcgttacttcaatcttttacagttcgcacgacaagaaaaagcggttta
gttgaaaaagttaatcggttagttcgttaa

DBGET integrated database retrieval system