KEGG   Acinetobacter baumannii TYTH-1: M3Q_712Help
Entry
M3Q_712           CDS       T02261                                 

Definition
folA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M3Q_712
   00670 One carbon pool by folate
    M3Q_712
Enzymes [BR:abh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     M3Q_712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(765500..766009)
Genome map
AA seq 169 aa AA seqDB search
MAWQNVKVVHVVAMDKNHCIGKGNALPWHISADLKHFKEITQGGVVIMGRKTLESMGRAL
PNRVNWVITRDINWHFDGVKIAYSIEDALNAALEDAKNTEKQALFIIGGGEIFKQTLSIA
DRLELTHVDLDVQGDAHYPTIPSEFHKTASEQQVDEKSGTSFEFATYKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcaaaatgtaaaagttgtccacgttgtcgcaatggacaaaaatcactgtatt
ggtaaaggcaatgcgttgccatggcatatctctgccgacttaaaacactttaaagaaatc
acacaaggtggtgtggtgatcatgggccgcaaaacgcttgagtctatgggccgtgctcta
ccgaaccgtgtgaactgggtaattacccgtgacattaactggcattttgacggcgtaaaa
attgcgtattcaattgaagatgctttaaatgctgctttagaagatgccaaaaacaccgaa
aagcaagctttattcattattggtggtggtgaaatctttaagcaaaccttgtcaattgca
gaccgtcttgagctcactcatgttgacttagatgtacaaggtgatgcacattatccaaca
ataccgagtgaatttcacaaaactgcaagcgaacagcaagtagatgaaaaatcaggaact
tcattcgaatttgccacttataaaaaataa

DBGET integrated database retrieval system