KEGG   Acinetobacter baumannii TYTH-1: M3Q_832Help
Entry
M3Q_832           CDS       T02261                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
898070..898552
Genome map
AA seq 160 aa AA seqDB search
MTVTTYIGLGSNLGDSRQILSEAIAKLKSLGEVKVSKLYQSPPMGPQDQPNYLNAVAQLK
TELLPLDLLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNEKIQNERLTVPHVGILQRD
FVVIPLLDLDADLHINDQPLKNLELIQQPTLTVLADESWA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaccacatatattggcttaggaagtaacctaggtgactcacgccagattctg
tctgaagcgatagccaaacttaaatctcttggtgaagtgaaagtatctaaactttaccaa
agtccccctatgggtccccaagatcagccgaattatctaaatgcagtcgctcagctaaaa
accgagttacttccgcttgacttacttgaccagttacagcgttttgagcaggaagctggg
cgggtaagactccgtcattggggggagcgaactttagatcttgatctactgatttatggc
aatgaaaaaatacaaaatgagcgcttaacggtgccgcatgtaggaatattacaacgagat
tttgttgtgattcctttattagatttagatgctgatctacatattaatgatcagccactt
aaaaatttagaactcatacaacagccaacgctgactgtacttgctgatgagtcttgggct
taa

DBGET integrated database retrieval system