KEGG   Acinetobacter baumannii TYTH-1: M3Q_877Help
Entry
M3Q_877           CDS       T02261                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:abh01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:abh00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
948779..950101
Genome map
AA seq 440 aa AA seqDB search
MVFLFRLVGKLMRRLSTQDQNFKQVFAELLAFETVNDPNLVQTVDQIIADVRQHGDDHVL
KLTQQFDRHPAHQFSDLELSQQQLKAAFDGLNQEIREALKLAADRIRTFHEAQKQDSWTY
VDDLGNTLGQKVTPLDRVGIYVPGGLASYPSSVLMNAVPAHVAGVPEIIMVVPAPNGELN
PLVLAAAYLAGVSRVFTIGGAQAVAALAYGTQTVPRVDKITGPGNRFVAAAKRAVFGQVG
IDMIAGPSEILVYAEGVNNAEWLAMDVLSQAEHDTVAQAIFITPDEALLEAVESAIEKHL
NELPKAEIARTSIKNRGALVLVKDRAEAVDLINQVAPEHLELCLDDAEAMSQDIRHAGAI
FMGRYTPEAIGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIMCSKDGVKTLAKTAD
VLAVQENLDAHARSARYRYQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttggtttttctttttcgccttgtgggtaaattgatgcgacgtttatcgactcaagatcag
aacttcaaacaggtttttgccgagcttttagcttttgaaaccgttaatgatcctaattta
gttcaaacagtagatcaaattattgctgatgttcgtcagcatggtgatgatcatgtttta
aaacttactcaacagttcgatcgacatccagcgcatcaattttccgatctagaattgtct
caacaacaacttaaagctgcttttgatggtttaaatcaagagattcgtgaagccctgaaa
cttgcagctgatcgtattcgtacttttcatgaagctcaaaaacaagatagctggacttat
gtggatgatttgggtaataccctaggacaaaaagtgactccacttgaccgtgttggtatt
tatgtaccaggcggacttgcatcttatccttcatctgtacttatgaatgcggtaccagca
catgtggctggtgtacctgaaattattatggttgtgccagccccaaatggtgaactaaat
ccactcgttttagctgccgcctatctagcaggtgttagccgagtatttaccattggtggg
gcacaagctgttgctgctttagcttatggtactcaaactgttccacgtgttgataaaatt
acgggtcctggaaaccgatttgtggcagctgctaaacgtgctgtatttggtcaggtgggt
attgacatgattgctggaccttctgaaatattagtttatgcagaaggtgtgaataatgct
gaatggttagcgatggatgtattatctcaagctgaacatgacacagtagctcaagctatt
ttcattactccagatgaagcattattagaagcagtagagtctgcaattgagaaacattta
aatgaattgcctaaagccgagattgcgcgtacatcgattaaaaatcgtggtgcattagtt
ttggtaaaagaccgtgctgaagcagttgatttaattaatcaggttgcaccagagcatttg
gaactatgtcttgatgatgctgaagcgatgagccaagatattcgtcatgcaggggcaatt
tttatgggtcgctatacacctgaagcaattggtgattattgtgctggcccaaaccacgta
ttaccgacatcaggcacagctcgtttctcttcgccacttggtgtatatgattttcaaaag
cgctctagtttgatcatgtgttcaaaagatggcgttaagactttggctaaaacagctgat
gtacttgctgttcaagaaaatctcgatgcccatgcacgctcggcgcgttatcgttatcaa
taa

DBGET integrated database retrieval system