KEGG   Aciduliprofundum boonei: Aboo_0187Help
Entry
Aboo_0187         CDS       T01180                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00010  Glycolysis / Gluconeogenesis
abi00030  Pentose phosphate pathway
abi00051  Fructose and mannose metabolism
abi00052  Galactose metabolism
abi00230  Purine metabolism
abi00500  Starch and sucrose metabolism
abi00520  Amino sugar and nucleotide sugar metabolism
abi00521  Streptomycin biosynthesis
abi01100  Metabolic pathways
abi01110  Biosynthesis of secondary metabolites
abi01120  Microbial metabolism in diverse environments
abi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_0187
   00030 Pentose phosphate pathway
    Aboo_0187
   00051 Fructose and mannose metabolism
    Aboo_0187
   00052 Galactose metabolism
    Aboo_0187
   00500 Starch and sucrose metabolism
    Aboo_0187
   00520 Amino sugar and nucleotide sugar metabolism
    Aboo_0187
  Nucleotide metabolism
   00230 Purine metabolism
    Aboo_0187
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Aboo_0187
Enzymes [BR:abi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Aboo_0187
    5.4.2.8  phosphomannomutase
     Aboo_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADD07999
JGI: Aboo_0187
UniProt: D3TBR4
Position
194620..195939
Genome map
AA seq 439 aa AA seqDB search
MQLFGTAGIRGITNRDITPELALKIAQAYGSVFSGDIAVARDTRYGAEMIERAVVSGLQS
TGNRVHLLGILPLPIFARFVADFMDGGIIVTGSHTPPQIMGIVPVDELGRDIYWDKAREI
EKIYNNGKEKTATWDRIEDTVFEDAVEHYMKFIERKAKNLSGFKIAVDPANGSGAGIIDR
ILENLGMDVYCIHCDRRHVPARPSEPRKETLQELRKISPNFDIGIGTDIDADRVLFASQG
EIFSEDTIGAIFAKFFAKERMVTPINSSSLIEYVAKRSGFEVIYCPVGPPEIAEHILRYK
ASYGYEETGKYIFPPKTLWGDSILSTINLLKIIDSQGKSLKELASEFPRYYQIKDKIAVE
REKKRKIVDKIGEFLERNMPPGAKNIVRVDGVKIIYEDSWLLIRASGTEDVIRIFSDAPS
LEKAKKLVDYGKNLVKNFI
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaattattcggcactgcaggcataagggggataacaaatagagatatcacccccgag
ctcgccttgaaaattgcccaagcatatggctctgtattctcaggagatatagcagttgca
agggacacaaggtacggagctgagatgattgagcgtgctgtggtctcaggattgcagagc
acaggaaatagagtgcatctcttaggcatcttaccattgcccatatttgcaagatttgta
gccgattttatggacggaggtataatcgtaacgggctctcacactccacctcagataatg
ggcatagtgccggtagatgaacttggaagggatatttactgggataaggcaagagagatt
gaaaaaatatacaataatggcaaggaaaaaactgctacttgggataggatagaagataca
gtttttgaggatgcagtagagcactatatgaaattcattgagcgaaaggcaaagaactta
tctggattcaaaattgctgtagaccctgcaaatggttctggagcggggataattgataga
attcttgagaatttaggaatggatgtttattgcattcattgtgataggaggcatgttcct
gcaagaccatccgagccgagaaaagaaacgctgcaagaattaagaaaaatatcaccaaat
tttgatattggaattggcactgatatagatgctgacagagttttatttgcctctcaaggg
gagatattttcagaggacacaataggggccatattcgcaaaattctttgcgaaggagagg
atggttacgcctataaactcatcctccctaattgaatatgtggcaaagagaagtggattt
gaagtcatatactgcccagtggggcctccagagatagcagagcatatcctgcgttataag
gcctcatacggatacgaggagacaggaaaatacatatttcccccaaaaacactgtggggc
gattccatattatcaacaatcaatctcttgaaaataattgactcacaaggaaagagttta
aaagaattggcaagcgagttccccagatattaccaaataaaagataaaattgctgtggag
agggagaaaaagagaaaaattgtggataaaataggagagtttcttgaaagaaatatgcca
ccgggtgcaaaaaatatagttagagttgatggcgtaaagataatttacgaggattcttgg
ctcttgattcgcgcctctggcacggaggatgttattcgcatattttcagatgcaccaagt
ttggaaaaagctaaaaaattggtagattatgggaaaaatttggttaaaaatttcatttag

DBGET integrated database retrieval system