KEGG   Aciduliprofundum boonei: Aboo_0299Help
Entry
Aboo_0299         CDS       T01180                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
Orthology
K00188  
2-oxoisovalerate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.7]
Organism
abi  Aciduliprofundum boonei
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aboo_0299
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     Aboo_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
297334..297660
Genome map
AA seq 108 aa AA seqDB search
MPIILPEEPTPIAKVPSTENKTGGWRTFRPIIHYDKCIRCYICWKFCPDAAIHFASPEAH
EAPKEALAKFDTVEINYDFCKGCGICANECPTKAIELVLEESFRGDEE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcccataatattgcctgaagaaccaacacccatagcaaaggttccaagcacagagaat
aaaacaggaggttggaggactttcagaccaatcatccattatgataaatgcatacgctgt
tatatatgctggaaattctgtccagacgcggctattcattttgcatcgccagaagcacat
gaggcaccaaaggaagcacttgccaaattcgatactgtggaaataaattacgatttctgc
aagggctgcggaatatgtgccaatgagtgcccaacaaaagccattgaacttgtgctagaa
gaaagtttcaggggtgatgaagaatga

DBGET integrated database retrieval system