KEGG   Aciduliprofundum boonei: Aboo_0299Help
Entry
Aboo_0299         CDS       T01180                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00188  2-oxoisovalerate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.7]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00280  Valine, leucine and isoleucine degradation
abi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aboo_0299
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     Aboo_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_16 Fer4_10 Fer4_6 Fer4_7 Fer4_21 Fer4_9 Fer4_2 Fer4_8 Fer4_13 Fer4_17 Fer4_4 Fer4_15 ETF_QO Fer4_22
Motif
Other DBs
NCBI-ProteinID: ADD08110
JGI: Aboo_0299
UniProt: B5IDN8
Position
297334..297660
Genome map
AA seq 108 aa AA seqDB search
MPIILPEEPTPIAKVPSTENKTGGWRTFRPIIHYDKCIRCYICWKFCPDAAIHFASPEAH
EAPKEALAKFDTVEINYDFCKGCGICANECPTKAIELVLEESFRGDEE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcccataatattgcctgaagaaccaacacccatagcaaaggttccaagcacagagaat
aaaacaggaggttggaggactttcagaccaatcatccattatgataaatgcatacgctgt
tatatatgctggaaattctgtccagacgcggctattcattttgcatcgccagaagcacat
gaggcaccaaaggaagcacttgccaaattcgatactgtggaaataaattacgatttctgc
aagggctgcggaatatgtgccaatgagtgcccaacaaaagccattgaacttgtgctagaa
gaaagtttcaggggtgatgaagaatga

DBGET integrated database retrieval system