KEGG   Aciduliprofundum boonei: Aboo_0300Help
Entry
Aboo_0300         CDS       T01180                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
Orthology
K00186  
2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.7]
Organism
abi  Aciduliprofundum boonei
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:abi00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
297657..298844
Genome map
AA seq 395 aa AA seqDB search
MKMILTGNESAAWGARLSKPKVIAAYPITPQTSIIETIAAFIANGEMDARYIRVESEHSA
MAACIAAQNTGVRTYTATSAHGLALMHEVLMWASGARLPIVMSVVNRAMAPPWSVWTDQL
DTMAERDSGWIQVYAQNNQEVLDSIIMSYKIAEKHNILLPTMVIEDAFILSHTSEGVDIP
EQKKVDDFLGEYIPAFKLDPDEPGGFGSLIMPEGPYMEFRYKMALAMDEARNEIKKVVEE
YNENFNRNYSPFIEEYRTEDADAVMVVLGTIGSTAKDVVDKMREKGKKVGVARVRYFRPF
PIDEIRALAKKTSMIGVVDRSYSFGPGADLYAETKSVLYGHTTIPVKNYVMGLGGRDITP
QVLEKVFNDMLAITKEGVVDREVEWVGLHGDERWS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgattctcacaggtaatgagagtgccgcctggggagctagactttcaaagcca
aaggtaattgctgcttatcccattactccccaaacgagcataattgaaacaattgcagct
ttcattgcaaatggagaaatggatgcacgatacattcgtgttgagagcgagcattctgca
atggctgcctgcatagcagctcaaaacacgggagtaaggacatacacggctactagtgcc
catggcctcgcacttatgcacgaggttttaatgtgggcgtccggcgcaagattgcccatt
gtaatgagcgttgtgaatcgcgcaatggctcctccgtggagcgtttggactgaccagctt
gataccatggcagagcgagatagtggatggatacaggtttatgctcagaataatcaggaa
gtgcttgattccataataatgtcctacaagattgcagaaaagcataatatcctcttaccc
actatggtaattgaagatgctttcattctatctcacacatcggaaggtgtagacatccca
gaacaaaagaaggtagatgatttcttaggggaatacattcctgcattcaaattggacccc
gatgagcctggtggatttggctctttgattatgcctgaggggccctatatggagttccgc
tacaagatggccctggcaatggatgaggcaagaaacgaaataaagaaagttgtggaggaa
tataacgagaatttcaataggaattattcaccattcatagaggagtatcgcacagaagat
gcagatgcagttatggttgttttgggcacaatcggttctacagcgaaggatgtggttgat
aaaatgagggagaagggcaagaaggttggagttgccagagttagatacttccgtccattc
cccatagatgaaatacgagctttagccaagaagacaagtatgattggcgtagtagataga
agctactccttcggtccaggcgcagatttgtacgctgagacaaaatccgtactctatggg
catacaaccatacctgtaaagaactatgtgatggggcttggtgggagagatataacacca
caggtacttgagaaggtattcaatgatatgcttgcaattacaaaagaaggggttgtagac
agagaggttgaatgggttggcttacatggagacgagaggtggtcataa

DBGET integrated database retrieval system