KEGG   Aciduliprofundum boonei: Aboo_0301Help
Entry
Aboo_0301         CDS       T01180                                 

Definition
thiamine pyrophosphate protein domain protein TPP-binding protein
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
abi  Aciduliprofundum boonei
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aboo_0301
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     Aboo_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
298844..299749
Genome map
AA seq 301 aa AA seqDB search
MKKLTIPEEEYMLPGHTACLGCGATIAMRYVLKALGKNTILSIPACCWAVIPGVYPHRTL
EVPLLYTAFEVTGASISGIREALDALGKEDVNVVGFAGDGGTADIGLQALSAAAERGHNV
FYIMYDNEAYMNTGIQRSGSTPMGAWTTTTPGGKKRIYKWEPKKNVAEIMVAHHIPYVAT
ATIAYPEDMIAKLKRAKEIKGPKFFQILSPCPTGWRHSPDKTVEISRLAVQTNIFPLYEV
INGKYKISIKPKNPKPVKEYLRLQGRFRHLTEEEIAMIQKNVDENWKALLKKERCSQEED
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaaccatacctgaagaggagtatatgcttcctgggcatactgcttgcctt
ggctgtggagcaacaatagccatgcgctatgttctaaaggcccttggtaaaaatacaatt
ttatccattccagcatgctgctgggctgtcattccaggcgtgtatcctcaccgaacttta
gaagttcccctgctctatactgcctttgaagttacaggagcctccatatcaggaatcaga
gaagctttggatgccctcggcaaagaagatgttaatgtcgtgggatttgcaggagatggt
ggtacagcagatattggccttcaagctctaagcgcagcagctgagcgcgggcataatgtt
ttctacataatgtatgataatgaggcatatatgaacacgggcatacagcgctccggctca
actcctatgggtgcttggactacaaccactcctggaggaaagaagaggatatacaagtgg
gaaccaaagaagaatgttgccgaaataatggtcgctcaccatatcccctatgtggccact
gccaccattgcttatcctgaggatatgattgccaaattgaagagagccaaggaaattaaa
ggcccaaaattcttccagattctatcaccttgcccaacgggatggagacattctccagat
aaaacagtggaaatatcacgcctggccgtgcaaacaaacatattcccgctctacgaggtt
ataaatggaaaatacaaaatttcaataaagccaaagaatccaaagccggtaaaggagtac
ctgcgtctccaaggcaggttcagacatttaaccgaggaagaaattgcgatgattcaaaag
aatgtggatgagaattggaaggcattgctgaagaaggagcgctgctcacaggaggaagat
gaatga

DBGET integrated database retrieval system