KEGG   Aciduliprofundum boonei: Aboo_0320Help
Entry
Aboo_0320         CDS       T01180                                 

Definition
(GenBank) acetyl coenzyme A synthetase (ADP forming), alpha domain protein
  KO
K01905  
acetate---CoA ligase (ADP-forming) subunit alpha [EC:6.2.1.13]
K22224  
acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_0320
   00620 Pyruvate metabolism
    Aboo_0320
   00640 Propanoate metabolism
    Aboo_0320
Enzymes [BR:abi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Aboo_0320
Lipid biosynthesis proteins [BR:abi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Aboo_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(321122..323257)
Genome map
AA seq 711 aa AA seqDB search
MENLDPIFKPKSIAIVGASRDPKAIGHQCVKNLIDSGYEGKIYPVNPKADEVAGLKCYHS
VLDIPDKVDIALIVVPAKLVPAVTEECGKKGVKGLVIIASGFSEVGREDLEREVVDIAHK
YGMRILGPNVVGIMNNPLHMNASFGPYLPYPGKAAMISQSGALLIAMDARTWVDKVGISH
MISIGNMADLDFGDLINYFNKDEDTNVISLYIEGVKDGRKFLNACKNSKKPIIALKAGTS
KRGAAAAASHTGSLAGSTKIYEAAFKQGHVVWAENLDALFDETMALALQKPMRGDNLLII
TNGGGVGVLATDAAEKYGVPIKDAPDDLKLLMFKHMPEFGNPKNPVDLTGMADRPEYEGS
IRDALKHDWVDGVVVLYCETSFTDPQNIAEGIYKAYKDSGVDKPIAVSLVGGERSVKAGE
WLIENGIPYYNSPHAAVRALAALRTYGRYLEKASKEFVPYKVNKEKVEAIIGKAKACGRS
LLTEPEAKEVFAAYGLPIPKGKMARNPEEAVKIARAVEYPVVMKIVSPNIVHKSDAGGVK
VNIKNDDEVRKAFQEIIENAERYDPHAEIMGVYVQHMEPWGTETIIGSINDSQFGPTVMF
GLGGIFVEILKDVTFRIAPFSKDEALDMVKEINGYGILKGARGEKPKDIEAIAEAVSRLS
QLVWDFRDVIKEVDANPVIVYEKGLSVVDARIILKTGKSTKVTPKPLDKCS
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggagaatttagatccaatattcaagccgaaaagtatagcaatcgtcggagcaagtcgt
gatccaaaggccataggacatcaatgcgttaagaatctcattgactcaggctatgagggc
aagatttatcctgtaaatcccaaggcagatgaagttgcagggctcaaatgctatcacagt
gttttggacattcctgataaggtggatattgcccttatagttgtacctgcaaagcttgtg
cctgccgttacggaagaatgtggaaagaagggagttaaaggccttgttataatagcttct
ggctttagcgaagttggcagagaggatttggagagagaggttgtggatattgcccacaaa
tacgggatgcgcatcctcggtccgaatgtcgtgggtataatgaataacccgcttcatatg
aatgcatcctttggcccatacttgccatatcctgggaaggcagcaatgatatcccaaagt
ggtgctttgctaatagcaatggatgcaaggacttgggttgataaagttggcatttcacat
atgataagtattggaaacatggcagatttggattttggagacctaatcaattacttcaac
aaggatgaggacacaaatgtcatatctctctacattgaaggtgtgaaggatggacgcaaa
ttcctaaacgcctgtaagaattcaaagaagccaataattgcgcttaaggcaggcacttca
aagcgtggtgcagctgcagcagcatcccatacaggaagtttggctggaagcacgaagata
tatgaggcagcattcaagcagggtcatgttgtgtgggccgaaaatctagatgctctattt
gatgagacaatggctctcgccttgcagaagccaatgaggggagataatcttctcataata
accaatggtggtggcgtaggagttctagctacagatgctgctgagaagtatggagtgcca
ataaaggatgcaccagatgacctaaaattgctcatgtttaagcatatgccagagtttgga
aatccgaaaaaccctgtggatttaactggcatggccgataggcctgaatacgagggttca
ataagggatgctttgaagcatgactgggttgatggagtggttgtgctttattgcgaaaca
tccttcacggatcctcaaaatattgctgagggaatttacaaggcttataaggatagtggt
gtggataagcccattgcagttagtttagtgggcggagagagaagcgtgaaagcgggagaa
tggctcatagagaatggaataccctactacaatagtccacatgcagccgttagagccctt
gcagccctcagaacctatggaagatacttggaaaaagcatcaaaggaatttgtaccttat
aaggttaacaaggagaaagtggaggcaataataggcaaggccaaggcatgcggaagaagc
ttactcactgagcccgaagcgaaggaggtatttgccgcctatggattgccgattccaaag
ggtaagatggctcggaatcctgaggaggccgttaagattgcccgtgcagttgagtatcct
gtggtaatgaaaatagtctctccaaatatagtgcataaaagtgatgcaggcggtgtaaag
gtgaatataaagaatgatgatgaagtgcgcaaggccttccaagagattatagagaatgca
gagcgctacgatcctcacgcggaaatcatgggtgtttatgtgcagcatatggagccatgg
ggtacggagacaattattggaagtatcaatgattctcaatttggaccaactgttatgttc
ggcctcggtggcatatttgtggaaattttgaaggatgtaacattccgtatagcaccattc
agcaaggatgaggcacttgatatggtcaaggaaataaatggctatggaatattgaaggga
gcacgcggtgagaaacccaaggacattgaagcaatagcagaagcggttagcaggttatcc
cagcttgtttgggatttcagagatgttataaaagaagtggatgctaatccagttatagtt
tacgagaaaggcctaagtgtagtggatgcaaggataatcctgaaaacaggaaaatccacg
aaggtaacaccaaagccactggataagtgcagttaa

DBGET integrated database retrieval system