KEGG   Aciduliprofundum boonei: Aboo_0320Help
Entry
Aboo_0320         CDS       T01180                                 

Definition
acetyl coenzyme A synthetase (ADP forming), alpha domain protein
Orthology
K09181  
acetyltransferase
Organism
abi  Aciduliprofundum boonei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(321122..323257)
Genome map
AA seq 711 aa AA seqDB search
MENLDPIFKPKSIAIVGASRDPKAIGHQCVKNLIDSGYEGKIYPVNPKADEVAGLKCYHS
VLDIPDKVDIALIVVPAKLVPAVTEECGKKGVKGLVIIASGFSEVGREDLEREVVDIAHK
YGMRILGPNVVGIMNNPLHMNASFGPYLPYPGKAAMISQSGALLIAMDARTWVDKVGISH
MISIGNMADLDFGDLINYFNKDEDTNVISLYIEGVKDGRKFLNACKNSKKPIIALKAGTS
KRGAAAAASHTGSLAGSTKIYEAAFKQGHVVWAENLDALFDETMALALQKPMRGDNLLII
TNGGGVGVLATDAAEKYGVPIKDAPDDLKLLMFKHMPEFGNPKNPVDLTGMADRPEYEGS
IRDALKHDWVDGVVVLYCETSFTDPQNIAEGIYKAYKDSGVDKPIAVSLVGGERSVKAGE
WLIENGIPYYNSPHAAVRALAALRTYGRYLEKASKEFVPYKVNKEKVEAIIGKAKACGRS
LLTEPEAKEVFAAYGLPIPKGKMARNPEEAVKIARAVEYPVVMKIVSPNIVHKSDAGGVK
VNIKNDDEVRKAFQEIIENAERYDPHAEIMGVYVQHMEPWGTETIIGSINDSQFGPTVMF
GLGGIFVEILKDVTFRIAPFSKDEALDMVKEINGYGILKGARGEKPKDIEAIAEAVSRLS
QLVWDFRDVIKEVDANPVIVYEKGLSVVDARIILKTGKSTKVTPKPLDKCS
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggagaatttagatccaatattcaagccgaaaagtatagcaatcgtcggagcaagtcgt
gatccaaaggccataggacatcaatgcgttaagaatctcattgactcaggctatgagggc
aagatttatcctgtaaatcccaaggcagatgaagttgcagggctcaaatgctatcacagt
gttttggacattcctgataaggtggatattgcccttatagttgtacctgcaaagcttgtg
cctgccgttacggaagaatgtggaaagaagggagttaaaggccttgttataatagcttct
ggctttagcgaagttggcagagaggatttggagagagaggttgtggatattgcccacaaa
tacgggatgcgcatcctcggtccgaatgtcgtgggtataatgaataacccgcttcatatg
aatgcatcctttggcccatacttgccatatcctgggaaggcagcaatgatatcccaaagt
ggtgctttgctaatagcaatggatgcaaggacttgggttgataaagttggcatttcacat
atgataagtattggaaacatggcagatttggattttggagacctaatcaattacttcaac
aaggatgaggacacaaatgtcatatctctctacattgaaggtgtgaaggatggacgcaaa
ttcctaaacgcctgtaagaattcaaagaagccaataattgcgcttaaggcaggcacttca
aagcgtggtgcagctgcagcagcatcccatacaggaagtttggctggaagcacgaagata
tatgaggcagcattcaagcagggtcatgttgtgtgggccgaaaatctagatgctctattt
gatgagacaatggctctcgccttgcagaagccaatgaggggagataatcttctcataata
accaatggtggtggcgtaggagttctagctacagatgctgctgagaagtatggagtgcca
ataaaggatgcaccagatgacctaaaattgctcatgtttaagcatatgccagagtttgga
aatccgaaaaaccctgtggatttaactggcatggccgataggcctgaatacgagggttca
ataagggatgctttgaagcatgactgggttgatggagtggttgtgctttattgcgaaaca
tccttcacggatcctcaaaatattgctgagggaatttacaaggcttataaggatagtggt
gtggataagcccattgcagttagtttagtgggcggagagagaagcgtgaaagcgggagaa
tggctcatagagaatggaataccctactacaatagtccacatgcagccgttagagccctt
gcagccctcagaacctatggaagatacttggaaaaagcatcaaaggaatttgtaccttat
aaggttaacaaggagaaagtggaggcaataataggcaaggccaaggcatgcggaagaagc
ttactcactgagcccgaagcgaaggaggtatttgccgcctatggattgccgattccaaag
ggtaagatggctcggaatcctgaggaggccgttaagattgcccgtgcagttgagtatcct
gtggtaatgaaaatagtctctccaaatatagtgcataaaagtgatgcaggcggtgtaaag
gtgaatataaagaatgatgatgaagtgcgcaaggccttccaagagattatagagaatgca
gagcgctacgatcctcacgcggaaatcatgggtgtttatgtgcagcatatggagccatgg
ggtacggagacaattattggaagtatcaatgattctcaatttggaccaactgttatgttc
ggcctcggtggcatatttgtggaaattttgaaggatgtaacattccgtatagcaccattc
agcaaggatgaggcacttgatatggtcaaggaaataaatggctatggaatattgaaggga
gcacgcggtgagaaacccaaggacattgaagcaatagcagaagcggttagcaggttatcc
cagcttgtttgggatttcagagatgttataaaagaagtggatgctaatccagttatagtt
tacgagaaaggcctaagtgtagtggatgcaaggataatcctgaaaacaggaaaatccacg
aaggtaacaccaaagccactggataagtgcagttaa

DBGET integrated database retrieval system