KEGG   Aciduliprofundum boonei: Aboo_0431Help
Entry
Aboo_0431         CDS       T01180                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.12)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_0431
   01230 Biosynthesis of amino acids
    Aboo_0431
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_0431
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Aboo_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(427743..428741)
Genome map
AA seq 332 aa AA seqDB search
MVRVAINGFGRIGRLVFRIGHRDLDIVAINDITDARTLAHLLKYDTNYGKFDGEVEYTEK
SLIINGREIPVFSERDPEKLPWKELGVDIVIESTGVFRSRDKAAKHLKAGARKVIITAPS
KGEPADVTIVLGVNQDKYDPEKHDVISNASCTTNCLAPVAKVLHENFGIKYALMSTVHSY
TNDQRVLDLPHRDLRRARAAAMNIIPTTTGAAKAIGLVIPELDGKMHGISIRVPTSTVSI
VDLVAEVEKEPTEEEVREAFKKAAEGELKGILQYVDEPLVSVDFKGNPHSAMYDALETYV
RGNLVKVLAWYDNEYGYSARVVDLVKYISQWL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgtagctataaatggttttggacgcatagggcgcttggtttttcgcatagga
catagggatctggatattgtggcaataaacgatataacggatgcacgcactctagcacat
ctcctaaagtacgataccaattatggaaaatttgatggagaggtggagtacactgaaaaa
agcttgattataaatggccgcgaaattccagttttcagcgagagggacccggaaaaactg
ccttggaaagaattgggagtggatatcgttatagagagcacgggagtatttcgctctaga
gataaggcggcaaagcatctaaaagcaggagcaaggaaggtgataataactgcaccatca
aagggagagccagcggatgttaccatagttctcggagtgaatcaggataagtatgacccg
gaaaagcatgatgtgataagcaacgcctcttgcaccaccaattgtttggcgcctgtggca
aaggtgctgcacgagaattttggaatcaagtatgccttgatgtccaccgtacattcctat
accaatgaccagcgtgttttagatttacctcatagagatttgcgcagggctagagcggca
gcaatgaatattatacccacaaccacgggggcagccaaggcaatagggcttgtaatacca
gaacttgatggaaagatgcatggcatatcaattcgtgtgcccacaagcacggtttccata
gtggatctcgtggctgaagttgaaaaggagcccacggaggaggaagtgagagaggccttc
aagaaggctgctgagggtgagttaaaagggatattgcagtatgttgatgagcccctcgtt
tccgtggatttcaaggggaatccgcatagcgctatgtatgatgctcttgaaacctatgtt
cgcgggaatcttgtgaaggttcttgcatggtatgataacgagtatggctattcggccagg
gttgtggacttggtgaagtacatatctcaatggctgtaa

DBGET integrated database retrieval system