KEGG   Aciduliprofundum boonei: Aboo_0432Help
Entry
Aboo_0432         CDS       T01180                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_0432
   01230 Biosynthesis of amino acids
    Aboo_0432
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_0432
   00030 Pentose phosphate pathway
    Aboo_0432
   00051 Fructose and mannose metabolism
    Aboo_0432
  Energy metabolism
   00680 Methane metabolism
    Aboo_0432
Enzymes [BR:abi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Aboo_0432
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Aboo_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
428835..429950
Genome map
AA seq 371 aa AA seqDB search
MDKITISLIKADVGGWPGHSTVHPDLIETAKEALQKAKDEHILEDFHVTGVGDDLQLIMT
HRKGVDSEEIHKLAWNTFEKATAVAKELKLYGAGQDLLKDAFSGNIRGMGPGIAEMEITE
RKSEPIVAFMMDKTEPGAFNLPIYRIFADPFNTAGLVIDPSMHDGFKFEVWDIMEHKKVI
MHSPKEMYDLLALIGAKSRYVIKRVYATESNPKVKGEVVAVVSTEKLYQIAGEYIGKDDP
VALVRAQSGCPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVSIKQAHCTRFDGPPRVAAL
GFQVANGRLVGPVDLFDDPAFDRARETAQYIADYMRRHGPFEPHRLPLEEMEYTTLPKVL
TKLKDRFEKIQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggataagataacaataagcttgattaaagcggatgtaggaggttggcccggacactcc
accgtgcatccagatttgattgaaactgccaaagaagctttgcagaaagcaaaggacgag
cacattttggaagatttccatgtgacaggcgtaggagacgatttgcaactcataatgacc
catcgtaaaggtgtggatagtgaggaaatccacaaattagcatggaacacctttgagaag
gcaaccgccgtggctaaagaattaaaactatatggcgctgggcaggacttactaaaggat
gcttttagcgggaacataaggggtatgggcccaggaatagcagaaatggaaataacggag
aggaagagcgagccaattgtggcttttatgatggataaaacagagccgggagctttcaac
ttacccatatacagaatatttgcggatccatttaatacagcaggattggtaattgaccca
agtatgcacgatggtttcaaatttgaagtatgggatataatggagcacaagaaagttata
atgcactctccaaaagagatgtacgatttgctcgctttgataggagcgaaaagcaggtat
gtcataaagagagtttatgctaccgagagcaatccaaaggtaaagggagaggttgtagca
gtggttagcacagagaaactctaccagattgcaggagagtacattggaaaggatgaccct
gtggcattggttagggcacagagcggttgcccagcgttgggcgaggtactagagcccttt
gcattcccccacctcgtatcaggatggatgcgtggttctcacaacggtcctcttatgccc
gttagcataaaacaggcacactgcacaagatttgatggtccaccaagagttgcagcatta
ggattccaagtggcaaatggaaggctcgttggacctgtggatttatttgatgaccccgca
tttgatagagccagggaaactgctcaatacatagccgactacatgcgccgccatggacca
tttgaaccccacagattgccactggaggaaatggagtatactaccttaccaaaggttctc
acaaaactcaaggacaggtttgaaaaaattcaataa

DBGET integrated database retrieval system