KEGG   Aciduliprofundum boonei: Aboo_0480Help
Entry
Aboo_0480         CDS       T01180                                 

Definition
(GenBank) PfkB domain protein
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
abi  Aciduliprofundum boonei
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Aboo_0480
   00240 Pyrimidine metabolism
    Aboo_0480
Enzymes [BR:abi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Aboo_0480
    2.7.1.213  cytidine kinase
     Aboo_0480
    2.7.1.-  
     Aboo_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
470752..471579
Genome map
AA seq 275 aa AA seqDB search
MSYLLYFGHVNIDVMLRVQNFGNVGESREVLGYETRLGGTAYNAYMSLLALRVPSKIFSV
IGPEIEGIDGYFVRDDKTPTCWLISDGREQMAYVYQGKWKELDRMEIDIPLKDFEWLHFS
TGNPKFYIGVARKAKELGRKISFDPSQEIHYIYDEKTFMEMLSLADLFFCNEKEYEKALD
FAKDKLFEKIIIRTEGEMGASIYMPNEGWDHIEAEEVNVVDTTGAGDTFRAGFYAALYYG
YGIKESVKYGNLAAAKVVQTKSTFYAGTWDDLNEK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaccttctttatttcgggcatgtaaacatcgatgtaatgctcagggttcaaaat
tttggaaatgtaggtgagagcagagaagtattaggatatgaaactaggcttggaggaaca
gcatacaatgcttatatgtcccttcttgctctgcgtgtgccctctaagattttctctgtt
atagggccagagattgaaggtatagatggatactttgtgagagatgataaaaccccaacc
tgctggcttataagcgatgggagagagcagatggcatatgtatatcagggtaagtggaaa
gagctggatagaatggaaattgatatacccttaaaagattttgaatggctccacttctcc
acaggaaatcctaaattctatattggggtggcaaggaaagcaaaagaattgggcagaaaa
ataagttttgacccttcgcaggagattcattatatttacgatgagaaaacatttatggaa
atgttatccttggccgatttatttttctgcaatgagaaggaatatgaaaaagcattagat
tttgctaaggataaactttttgagaagattataattagaactgaaggcgagatgggagca
agtatatatatgccgaatgagggatgggatcacatagaggctgaggaagtgaatgttgtg
gacaccactggggcgggagatactttcagagcagggttctatgcagcattatattatggc
tatggaataaaagaatcggtcaagtatggaaatttggcagcagcaaaggttgtgcaaacc
aagagtacattttacgctggtacttgggatgatttgaatgagaaataa

DBGET integrated database retrieval system