KEGG   Aciduliprofundum boonei: Aboo_0509Help
Entry
Aboo_0509         CDS       T01180                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_0509
   01230 Biosynthesis of amino acids
    Aboo_0509
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_0509
   00051 Fructose and mannose metabolism
    Aboo_0509
   00562 Inositol phosphate metabolism
    Aboo_0509
Enzymes [BR:abi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aboo_0509
Exosome [BR:abi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aboo_0509
  Exosomal proteins of bladder cancer cells
   Aboo_0509
  Exosomal proteins of melanoma cells
   Aboo_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
493271..493942
Genome map
AA seq 223 aa AA seqDB search
MWKTPVLIVNFKLYKSGVGEKALELARILDKVSKERGVSIIAAVNTFDAYRIKNEVKIPV
ILQHADAVEFGAHTGRINVELAREYNLDGLLINHSERMLKISDIDFLIQKSKDLNMVSVV
CANNSRVAGALAFLEPDFIAMEPPELIGGNVSVSTAKPEAIVETIEAVKSVRNIPVLVGA
GIKNGKDVRKAIELGAEGVLVASGVVKAKDPEMALNDLIGGMM
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaacaccagtgctcattgtgaatttcaaactttacaaatctggagttggtgag
aaagctctcgagcttgcaagaatcttggataaagtatctaaggaaagaggggtaagtata
atagcggccgtcaacacttttgatgcttacagaataaagaatgaggttaaaattcctgtg
atattgcaacatgccgatgctgttgagttcggagcgcatacgggcaggataaatgtggag
ttggcgagggagtacaatttggatggtttgctcataaatcactctgaaaggatgctaaaa
atatccgatattgattttctaattcaaaaatccaaggatttgaatatggtctctgtggtt
tgtgctaacaactctcgagtggctggagctttagcgttcttagagccagatttcattgcc
atggagccccccgaactcataggcggaaatgtgtccgtatccactgcaaagcctgaagca
atagtggagacaatagaagcagttaaatccgttagaaacatacccgtgcttgtgggtgcg
ggaataaaaaatggtaaagatgttagaaaggccatagagttgggtgctgaaggtgtgctt
gtcgcctctggagtggtgaaggcaaaggatccagaaatggctttgaatgaccttatagga
gggatgatgtaa

DBGET integrated database retrieval system