KEGG   Aciduliprofundum boonei: Aboo_0528Help
Entry
Aboo_0528         CDS       T01180                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_0528
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_0528
   00052 Galactose metabolism
    Aboo_0528
   00500 Starch and sucrose metabolism
    Aboo_0528
   00520 Amino sugar and nucleotide sugar metabolism
    Aboo_0528
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Aboo_0528
   00524 Butirosin and neomycin biosynthesis
    Aboo_0528
Enzymes [BR:abi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Aboo_0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
511674..512474
Genome map
AA seq 266 aa AA seqDB search
MTLGIDVGGTKILAARIEKGKIWEKWKFKTKNDEVIKIIEEIIERSAERVVGIGVPCYLR
NGVCINAPNISEFNGKDLRHYFKRTIIMNDCTAMAYGEYVLRNEKYNSLLLVSLGTGVGA
GLVFKGVPYIGKGSAMELGHIKGFSNRQCACGKTGCFETVVGGRYVEVEERAKRAMEGDK
EAIEFMKEYGRAIARGLSYAIQLLDPEIVVFGGGISNAYELFIEPVKEELYGLLSFIDVD
DIIFEKAKSEDSGAFGAALIAERRLL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactcttgggattgatgttgggggcacaaaaattcttgcagcaagaattgagaaaggg
aaaatttgggagaagtggaaatttaaaacaaagaatgatgaagtgataaaaattattgag
gaaataattgagaggtcggcagaaagagtcgtgggaattggcgtaccttgctacttgagg
aatggggtatgcattaatgcaccgaatatatcggaatttaatggaaaggatttgagacat
tattttaaaagaaccataatcatgaacgattgcaccgccatggcttacggggagtatgtt
cttagaaatgaaaaatacaattctcttcttttggtatctttaggtacgggagtgggtgcg
ggacttgtttttaaaggagttccctatattggtaagggaagtgccatggagcttggccat
ataaagggattttccaatcggcaatgtgcctgtggtaaaacaggatgctttgaaacggta
gttggaggcaggtatgtagaagtagaggaaagggcaaaaagggcgatggagggggataaa
gaagcgattgaatttatgaaagaatatgggcgggcaatagccagaggattatcttatgcc
attcagttattggatcccgaaattgtagtttttggaggaggtatatcaaacgcttatgaa
ctatttattgaacctgtgaaagaagagttatatgggcttttaagttttatagatgttgat
gatataatttttgaaaaggcaaagagtgaagattctggagcttttggtgctgcgcttata
gcagagagaagattgctttaa

DBGET integrated database retrieval system