KEGG   Aciduliprofundum boonei: Aboo_0634Help
Entry
Aboo_0634         CDS       T01180                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aboo_0634
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aboo_0634
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Aboo_0634
Enzymes [BR:abi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Aboo_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
605785..606906
Genome map
AA seq 373 aa AA seqDB search
MFVCTACGRKFSLEEHHQRCPICNEPLQLENMKGKRRDGNVWERYRDFYSIPLSMDYSLG
EGDTPIIRVDMYGNEFYLKNETLNPTWSFKDRGTFVAINRAIQMGFDRIGVVSTGNMAAS
VAAYGAHAGLDTIVLVSENILNEKISQLLPYGAKILKVKGDYGELYFKSLKIGKTRKIYF
MNSDDPFRIEGYKTIAYELAEKVDVDYVFVPTSSGGLFRGVYKGFLELKESGTIDKIPEM
VAVQAKGCSPICSAYPSGKIGRFKNASTIAHAIENPYPPSGNAVLRILKKNGWKCIAVEE
DEIIKAQEELAYKGIFVQPASATTLAVLKKLNLKNSRIALILTGSGLKTKSIEYSKTIPL
CDIEELEDCEVFK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtatgcactgcctgtggtagaaaattctccttagaagagcatcatcagagatgc
ccaatttgcaacgagcccttgcagttggagaatatgaaggggaagagaagagatggaaat
gtgtgggagagatacagagatttttattcaattcctttgagcatggattacagcttgggg
gagggagatacaccaataattcgagttgatatgtatggaaatgagttttatctcaagaat
gagactttgaatccaacttggagctttaaagataggggtacttttgtggcgataaacagg
gcgattcaaatgggatttgataggataggcgtggtatccactggcaacatggctgcaagt
gtggctgcttatggggcacatgcgggattggatacgatagttcttgtatcagagaatata
ctaaatgagaaaatatcccaacttttaccctacggggctaagattttaaaagtgaaaggt
gactatggagagctgtattttaaatctttgaaaatcgggaaaacgagaaaaatatatttt
atgaactcagatgacccttttcgaatagagggctataaaacaattgcatatgagctcgcc
gaaaaggtggatgtggattatgttttcgtgcccacgagttctggaggattgttcaggggt
gtttataaggggtttctagagttgaaggagagtggaacaatagataaaattccggagatg
gttgctgtgcaagctaagggttgctcgccaatatgcagtgcttatccctcaggcaaaatt
gggagatttaagaatgcaagtacaatcgcacatgcgatagagaatccgtatcctccaagc
ggaaatgctgttctaaggatattgaaaaagaatgggtggaaatgtattgcagttgaagag
gatgagataataaaagctcaagaagagcttgcttataagggaatttttgttcagcctgcc
tctgccacaactcttgcagtccttaaaaaattaaacttgaaaaattcaagaatagccctt
atcttaacaggctcagggctcaaaacgaaaagtatagaatactcaaaaacaataccttta
tgtgatattgaagagttggaagattgtgaggtgtttaaatga

DBGET integrated database retrieval system