KEGG   Aciduliprofundum boonei: Aboo_0634Help
Entry
Aboo_0634         CDS       T01180                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00260  Glycine, serine and threonine metabolism
abi00750  Vitamin B6 metabolism
abi01100  Metabolic pathways
abi01110  Biosynthesis of secondary metabolites
abi01120  Microbial metabolism in diverse environments
abi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aboo_0634
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Aboo_0634
Enzymes [BR:abi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Aboo_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TrkA_N DZR zf-C3HC4_3 HypA Orthopox_F6 Glyco_hydro_57 Zn-ribbon_8 ADK_lid zf-C3HC4_2 zinc-ribbons_6
Motif
Other DBs
NCBI-ProteinID: ADD08445
JGI: Aboo_0634
UniProt: B5I9S6
Position
605785..606906
Genome map
AA seq 373 aa AA seqDB search
MFVCTACGRKFSLEEHHQRCPICNEPLQLENMKGKRRDGNVWERYRDFYSIPLSMDYSLG
EGDTPIIRVDMYGNEFYLKNETLNPTWSFKDRGTFVAINRAIQMGFDRIGVVSTGNMAAS
VAAYGAHAGLDTIVLVSENILNEKISQLLPYGAKILKVKGDYGELYFKSLKIGKTRKIYF
MNSDDPFRIEGYKTIAYELAEKVDVDYVFVPTSSGGLFRGVYKGFLELKESGTIDKIPEM
VAVQAKGCSPICSAYPSGKIGRFKNASTIAHAIENPYPPSGNAVLRILKKNGWKCIAVEE
DEIIKAQEELAYKGIFVQPASATTLAVLKKLNLKNSRIALILTGSGLKTKSIEYSKTIPL
CDIEELEDCEVFK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtatgcactgcctgtggtagaaaattctccttagaagagcatcatcagagatgc
ccaatttgcaacgagcccttgcagttggagaatatgaaggggaagagaagagatggaaat
gtgtgggagagatacagagatttttattcaattcctttgagcatggattacagcttgggg
gagggagatacaccaataattcgagttgatatgtatggaaatgagttttatctcaagaat
gagactttgaatccaacttggagctttaaagataggggtacttttgtggcgataaacagg
gcgattcaaatgggatttgataggataggcgtggtatccactggcaacatggctgcaagt
gtggctgcttatggggcacatgcgggattggatacgatagttcttgtatcagagaatata
ctaaatgagaaaatatcccaacttttaccctacggggctaagattttaaaagtgaaaggt
gactatggagagctgtattttaaatctttgaaaatcgggaaaacgagaaaaatatatttt
atgaactcagatgacccttttcgaatagagggctataaaacaattgcatatgagctcgcc
gaaaaggtggatgtggattatgttttcgtgcccacgagttctggaggattgttcaggggt
gtttataaggggtttctagagttgaaggagagtggaacaatagataaaattccggagatg
gttgctgtgcaagctaagggttgctcgccaatatgcagtgcttatccctcaggcaaaatt
gggagatttaagaatgcaagtacaatcgcacatgcgatagagaatccgtatcctccaagc
ggaaatgctgttctaaggatattgaaaaagaatgggtggaaatgtattgcagttgaagag
gatgagataataaaagctcaagaagagcttgcttataagggaatttttgttcagcctgcc
tctgccacaactcttgcagtccttaaaaaattaaacttgaaaaattcaagaatagccctt
atcttaacaggctcagggctcaaaacgaaaagtatagaatactcaaaaacaataccttta
tgtgatattgaagagttggaagattgtgaggtgtttaaatga

DBGET integrated database retrieval system