KEGG   Aciduliprofundum boonei: Aboo_0635Help
Entry
Aboo_0635         CDS       T01180                                 

Definition
Glycine hydroxymethyltransferase (EC:2.1.2.1)
Orthology
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_0635
   01230 Biosynthesis of amino acids
    Aboo_0635
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Aboo_0635
  Energy metabolism
   00680 Methane metabolism
    Aboo_0635
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aboo_0635
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Aboo_0635
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Aboo_0635
Enzymes [BR:abi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     Aboo_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
606903..608087
Genome map
AA seq 394 aa AA seqDB search
MNPQGIIQLHDEYRKRVLNMQASENFLSYRVRKALASDMASRYSMLFDKEVHGSFVHNAY
GGTKYQEEIKEYAENKAREIFGFKFANVKPISGHIAAMTVLLSLTNKGDKIMAIPPELGG
YDGYSQPYMPDMFDLNFVPLDMEDMRRIDVEKIRREKPKLIILGASYILFPYNLTEVLEV
AEEIGARVVYDASHIMGLLPAGFQEDIEKCDAVYGSTHKSFPGPQGGIIFTNDESVDEKI
EENLTWRTQDNYHTNRVAALAMALYEFSPVAKIYGKNVAENSRALARALEEGGLGIKHSP
EYTNSHQVLVDENSLKDEFSLTPPQMSEVLEENGIIVDSVGRIGTAELTWKGYGPEDMRE
IAGIIIAALEGEDVKEEVLRMVDKWDGKTMGSRI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcagggtataattcaacttcacgatgagtatagaaaaagagtgctcaatatg
caagcttcagagaattttttatcttatagggttcgcaaagctctagcatcggacatggcc
tcgcggtacagcatgctctttgataaagaggtgcatggctccttcgtgcataatgcctat
gggggcacgaaatatcaggaggagataaaagaatacgccgagaataaggcaagggagatt
tttggatttaaatttgccaatgtaaaacccatatccgggcatattgccgctatgactgtt
cttctctctctcacaaataagggagataaaataatggccatacctccggaactggggggc
tatgatgggtactctcagccatatatgcccgatatgtttgaccttaattttgtccctctt
gatatggaggatatgcgtagaatagatgtggagaagataagaagagagaagccaaaattg
ataattcttggggccagttacattctattcccttacaacctcactgaagttttggaagta
gcggaagagatcggggcaagggtggtttatgatgcctcccatattatgggcctcttgccc
gctggatttcaagaggatattgagaaatgcgatgccgtttacggctctactcacaaatcc
ttccctggacctcagggagggataatattcacgaatgatgaaagtgtggacgagaaaatt
gaggagaacttaacttggcgcactcaagataattaccatacaaacagggttgctgcattg
gccatggctctctacgaattctctccagtggccaagatttatggaaaaaatgtggccgaa
aattctagagcgctggccagagcacttgaagaaggaggacttggaatcaagcactcgcct
gagtatacaaattcgcatcaggttttagtggatgaaaattcattgaaggatgaattctct
ttaactcctccccagatgagcgaagtgcttgaagagaacggtattatagttgactctgtg
ggaagaataggcactgccgaactaacttggaaaggatatgggcctgaggatatgagagag
attgcagggattataatagcagcactggaaggagaggatgttaaggaggaagtattgcgc
atggttgataaatgggatggtaaaacgatgggaagtagaatataa

DBGET integrated database retrieval system