KEGG   Aciduliprofundum boonei: Aboo_0986Help
Entry
Aboo_0986         CDS       T01180                                 

Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
abi  Aciduliprofundum boonei
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_0986
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aboo_0986
   00640 Propanoate metabolism
    Aboo_0986
   00660 C5-Branched dibasic acid metabolism
    Aboo_0986
Enzymes [BR:abi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Aboo_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
951508..952614
Genome map
AA seq 368 aa AA seqDB search
MNLYEYQGKALFRKFGVPTPEGYVAFKPEDIKEFEGERVIKAQVLTGGRGKSGGVKFASS
LEEARELARQILAMEIKGHKVHAVLVEEKLKIEKEFYVSILIDRSTRSPLIMASPEGGVE
IESVPDEKIYKFVVNPEIGVQPFVGRLLSKKMGFTGDLAKQFTKILMNLYHMFREYDAEL
VEINPLVLSEGKLIAADSKVVIDTDSLYRHKDLEENAEEKTPLELEANKAGYAFVELDGN
VGVIANGAGLTMATLDTLLLYGLKPRNFLDLGGTDSVDITKNAFTYVLKANPDAILVNIF
GGVTKCDTVAQGIIAAKDAFNINLPIVVRLSGVHEEEGRKMLEEKGIHAFADMRHAIEKL
KSIMEGSQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgtacgaatatcaaggaaaagcactctttagaaaatttggagtgccaacgcct
gagggctatgtagccttcaagccagaggatatcaaagagtttgagggagaaagagtgata
aaagcgcaagttctgacaggcggcaggggcaagagtggaggcgtgaagtttgcctccagt
ttagaagaggctcgagagcttgctcgacagatacttgccatggagatcaagggccacaaa
gtacacgcagttctcgtggaggagaagttgaagattgagaaagagttctatgttagtata
ttgatagatagaagtactagaagcccgctcataatggcatctcctgagggaggtgtagag
atagagagtgtacctgatgagaagatttacaagttcgttgtaaatcctgagattggtgta
cagccatttgtgggtagattgctctctaagaaaatgggctttactggagatctggccaag
caattcaccaagattctaatgaatctctaccacatgttccgcgagtacgatgcagagctg
gttgaaatcaatcccctcgttctgagcgagggaaagttaattgctgcggactctaaggtg
gtaatagatacagactccctatacaggcacaaggaccttgaggagaacgcagaggagaaa
actccgctggaattagaggcaaacaaagcgggatatgctttcgttgaattagatggtaat
gtgggagtcatagccaacggtgcaggattaaccatggccacgctggatactttgctttta
tatgggctgaagcccagaaacttcttggatttgggcggcacagatagcgtggatataaca
aagaacgctttcacttatgtgcttaaagcaaatcctgatgcgattctagttaacatattc
ggtggcgttacgaaatgcgacaccgttgcacagggtataatagcggctaaagatgctttc
aatatcaacttgcccatagttgtgcgcttgagcggcgtgcatgaagaagaaggccgcaag
atgcttgaagaaaagggcatacatgcatttgcagatatgcgccatgctattgagaagctt
aaatctattatggagggatcgcaatga

DBGET integrated database retrieval system