KEGG   Aciduliprofundum boonei: Aboo_1085Help
Entry
Aboo_1085         CDS       T01180                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
abi  Aciduliprofundum boonei
Brite
Enzymes [BR:abi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Aboo_1085
Transfer RNA biogenesis [BR:abi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Aboo_1085
Chromosome and associated proteins [BR:abi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Aboo_1085
   HAT complexes
    Elongator complex
     Aboo_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: ADD08894
JGI: Aboo_1085
UniProt: B5IH57
Position
complement(1040522..1042066)
Genome map
AA seq 514 aa AA seqDB search
MGFYEDIAQIFRKGEIKSKEDLEKWKSRIAKKYRIPNPRNSEIMKHLPKDIVERYHSILV
KKPSRTLSGVAVVAIMTSPFPCPHGKCIYCPGGPEKGTAQSYTGHEPAALRAAQYNFDPY
EQTRARIEQLRAIGHPTDKIDLIIMGGTFTARPQSYQEWFVKRAFDAMNGVDAKNLEEAQ
LINEDAKNRCIGLTVETRPDWFMEKEIDFALKLGATRVELGIQTVYDDILEKVKRGHTIR
ESILATRLAKDAGFKINYHMMPGLPGSSLERDYKAFKEIFENPNFRPDMLKIYPTLVVKG
TELYEMWKKGEYEPYTLEEMVELLIKVISIVPPWVRIQRIQRDIPAKFIEAGVKKGDLRA
IVLKEMEKRGIRCPDIRCREVGRKGGNNFEMIRRDYNASSGKEVFLSFEDKDADSIAAFL
RLRLPSKYAHRSEMRNAAIVREVKVFGKEVPVGEKEKEAWQHRGFGKELMNEAERISKEE
WGVARVVVISGIGVRNYYRKLGYERLGPYMAKRI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgggattctatgaagacatagcgcaaatttttcggaaaggtgagataaagagcaaggag
gatttggagaagtggaagagcagaattgcaaagaagtacaggattcccaacccgagaaat
tctgagattatgaaacacctacccaaagatattgttgaaagatatcatagcattttagtt
aaaaagccctctcgcactctaagtggcgtggctgtcgtggcgattatgacttctccattc
ccatgtccacatggaaaatgtatatactgcccaggcggtcctgagaaaggcactgcccag
agttacacagggcacgagccagcagcacttagggctgcacagtataattttgacccatac
gagcagacaagggcgagaatagagcaattgagagcaataggacatccaactgataaaatt
gacctcatcattatggggggcacattcacagccaggcctcaaagctatcaggagtggttc
gttaagcgtgcttttgatgctatgaatggcgtggatgccaagaacttggaagaagcacag
ctgattaacgaggatgcaaagaacagatgcatagggcttacagttgagacccgtcctgat
tggttcatggaaaaagagattgattttgctttgaaattaggagcaacaagagttgagctt
gggatacaaacggtctacgatgatattttggaaaaagtgaaaagaggacatacaataaga
gagagcattcttgctactcggcttgcaaaggatgcaggtttcaaaatcaattatcatatg
atgccaggtctgcctggaagctctcttgagagggattacaaggcatttaaagagatattt
gaaaatccgaatttcaggccagatatgctcaaaatttatcctactttggttgtaaaaggc
acggagctttatgaaatgtggaaaaagggagaatacgagccctacactctcgaggaaatg
gtggagttattaatcaaggtgataagcatcgttcccccatgggttcgcatacagagaatc
cagagggatattccagcaaagttcatagaggcgggggtgaaaaaaggagatttgagggca
atagttcttaaagaaatggaaaaaaggggaataagatgcccggatataagatgcagagaa
gttggccgtaaaggaggaaataattttgaaatgatacgcagggattataatgcctcttca
ggtaaagaagttttcttatcttttgaagataaggatgccgattcaatagcagcatttctc
cgtttaagattgcctagcaaatatgctcatcgtagtgagatgcgcaacgccgctattgtt
cgggaggtaaaggtatttggaaaagaagtgcctgtgggggaaaaagagaaagaggcatgg
cagcaccgcggattcgggaaagagctgatgaatgaggcagagagaatttctaaagaagaa
tggggagtggctcgggtggtggtaataagcggtattggagtgaggaattactatcgtaaa
ctcggctacgagagattaggaccgtacatggcaaagagaatttga

DBGET integrated database retrieval system