KEGG   Aciduliprofundum boonei: Aboo_1260Help
Entry
Aboo_1260         CDS       T01180                                 

Definition
Pyridoxal-5'-phosphate-dependent protein beta subunit
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
abi  Aciduliprofundum boonei
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_1260
   01230 Biosynthesis of amino acids
    Aboo_1260
  Energy metabolism
   00920 Sulfur metabolism
    Aboo_1260
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Aboo_1260
Enzymes [BR:abi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Aboo_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1207283..1208167
Genome map
AA seq 294 aa AA seqDB search
MQVFELIGNTPTLRVENIWLKLEFMNPTGSHKDRIAYYMIEEAKNKGLKKGRYVIEYTSG
NTGISVTWLSKLMGYKPLILLPENIVEEKRALIKALGGEIRIVKEGEDGHLLAEKLAEEL
KGVYLHQTENLANFRAHYETTAPELFSQVKNIDCFVMGAGTGGTIYGIGKYLKARNEKIK
VVLLVPKGSQLQEEFFEKREKDMELLEGFSYHSYSKLLKKAIDENIIDEIRVVSAEEAIK
GTKMLMSYGILGGFTAGANFYQAKKMEKNCRNIATIVADSIIRYPSRMELIQQI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttttgagcttataggcaacactcctactttgagagttgaaaatatatggcta
aaacttgaatttatgaacccaacagggagccataaggatagaatcgcttattatatgata
gaggaggcaaaaaacaaaggtttgaaaaaaggaagatatgttattgaatacacctccgga
aatacgggtatatctgtaacttggctctcaaaattaatgggctataaacccctaatatta
cttcctgaaaacattgttgaagagaagagggctcttatcaaggccttgggtggggagata
agaattgtaaaagagggcgaagatggtcatcttctagccgagaaacttgcagaagagtta
aaaggtgtatatctgcatcaaacagaaaacttggcgaatttcagagcccattacgaaact
acagcaccagaattattttctcaggtaaaaaatattgattgttttgtgatgggcgcaggt
actggtggcaccatatacggcattggaaaatatttaaaagcgagaaacgaaaaaataaag
gttgtactcttggttccaaagggctctcagcttcaagaggagttctttgaaaagagggaa
aaggatatggaactgctcgagggtttctcttatcattcctacagcaaactactcaagaaa
gcgatagatgaaaatataattgatgaaattagagtagtaagcgcagaagaggctattaaa
ggcacaaaaatgcttatgtcttacggcatattagggggattcacagccggagcaaatttt
tatcaagcaaagaaaatggagaaaaattgtagaaatatagccacgatagtggccgattcc
attatacgctatccatctcgaatggaactcattcagcagatttag

DBGET integrated database retrieval system