KEGG   Aciduliprofundum boonei: Aboo_1260Help
Entry
Aboo_1260         CDS       T01180                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01738  cysteine synthase A [EC:2.5.1.47]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00270  Cysteine and methionine metabolism
abi00920  Sulfur metabolism
abi01100  Metabolic pathways
abi01110  Biosynthesis of secondary metabolites
abi01120  Microbial metabolism in diverse environments
abi01130  Biosynthesis of antibiotics
abi01200  Carbon metabolism
abi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Aboo_1260
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Aboo_1260
Enzymes [BR:abi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Aboo_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADD09068
JGI: Aboo_1260
UniProt: B5ICJ1
Position
1207283..1208167
Genome map
AA seq 294 aa AA seqDB search
MQVFELIGNTPTLRVENIWLKLEFMNPTGSHKDRIAYYMIEEAKNKGLKKGRYVIEYTSG
NTGISVTWLSKLMGYKPLILLPENIVEEKRALIKALGGEIRIVKEGEDGHLLAEKLAEEL
KGVYLHQTENLANFRAHYETTAPELFSQVKNIDCFVMGAGTGGTIYGIGKYLKARNEKIK
VVLLVPKGSQLQEEFFEKREKDMELLEGFSYHSYSKLLKKAIDENIIDEIRVVSAEEAIK
GTKMLMSYGILGGFTAGANFYQAKKMEKNCRNIATIVADSIIRYPSRMELIQQI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttttgagcttataggcaacactcctactttgagagttgaaaatatatggcta
aaacttgaatttatgaacccaacagggagccataaggatagaatcgcttattatatgata
gaggaggcaaaaaacaaaggtttgaaaaaaggaagatatgttattgaatacacctccgga
aatacgggtatatctgtaacttggctctcaaaattaatgggctataaacccctaatatta
cttcctgaaaacattgttgaagagaagagggctcttatcaaggccttgggtggggagata
agaattgtaaaagagggcgaagatggtcatcttctagccgagaaacttgcagaagagtta
aaaggtgtatatctgcatcaaacagaaaacttggcgaatttcagagcccattacgaaact
acagcaccagaattattttctcaggtaaaaaatattgattgttttgtgatgggcgcaggt
actggtggcaccatatacggcattggaaaatatttaaaagcgagaaacgaaaaaataaag
gttgtactcttggttccaaagggctctcagcttcaagaggagttctttgaaaagagggaa
aaggatatggaactgctcgagggtttctcttatcattcctacagcaaactactcaagaaa
gcgatagatgaaaatataattgatgaaattagagtagtaagcgcagaagaggctattaaa
ggcacaaaaatgcttatgtcttacggcatattagggggattcacagccggagcaaatttt
tatcaagcaaagaaaatggagaaaaattgtagaaatatagccacgatagtggccgattcc
attatacgctatccatctcgaatggaactcattcagcagatttag

DBGET integrated database retrieval system