KEGG   Aciduliprofundum boonei: Aboo_1260Help
Entry
Aboo_1260         CDS       T01180                                 

Definition
Pyridoxal-5'-phosphate-dependent protein beta subunit
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
abi  Aciduliprofundum boonei
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:abi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:abi01230]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:abi00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:abi00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1207283..1208167
Genome map
AA seq 294 aa AA seqDB search
MQVFELIGNTPTLRVENIWLKLEFMNPTGSHKDRIAYYMIEEAKNKGLKKGRYVIEYTSG
NTGISVTWLSKLMGYKPLILLPENIVEEKRALIKALGGEIRIVKEGEDGHLLAEKLAEEL
KGVYLHQTENLANFRAHYETTAPELFSQVKNIDCFVMGAGTGGTIYGIGKYLKARNEKIK
VVLLVPKGSQLQEEFFEKREKDMELLEGFSYHSYSKLLKKAIDENIIDEIRVVSAEEAIK
GTKMLMSYGILGGFTAGANFYQAKKMEKNCRNIATIVADSIIRYPSRMELIQQI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttttgagcttataggcaacactcctactttgagagttgaaaatatatggcta
aaacttgaatttatgaacccaacagggagccataaggatagaatcgcttattatatgata
gaggaggcaaaaaacaaaggtttgaaaaaaggaagatatgttattgaatacacctccgga
aatacgggtatatctgtaacttggctctcaaaattaatgggctataaacccctaatatta
cttcctgaaaacattgttgaagagaagagggctcttatcaaggccttgggtggggagata
agaattgtaaaagagggcgaagatggtcatcttctagccgagaaacttgcagaagagtta
aaaggtgtatatctgcatcaaacagaaaacttggcgaatttcagagcccattacgaaact
acagcaccagaattattttctcaggtaaaaaatattgattgttttgtgatgggcgcaggt
actggtggcaccatatacggcattggaaaatatttaaaagcgagaaacgaaaaaataaag
gttgtactcttggttccaaagggctctcagcttcaagaggagttctttgaaaagagggaa
aaggatatggaactgctcgagggtttctcttatcattcctacagcaaactactcaagaaa
gcgatagatgaaaatataattgatgaaattagagtagtaagcgcagaagaggctattaaa
ggcacaaaaatgcttatgtcttacggcatattagggggattcacagccggagcaaatttt
tatcaagcaaagaaaatggagaaaaattgtagaaatatagccacgatagtggccgattcc
attatacgctatccatctcgaatggaactcattcagcagatttag

DBGET integrated database retrieval system