KEGG   Aciduliprofundum boonei: Aboo_1324Help
Entry
Aboo_1324         CDS       T01180                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
abi  Aciduliprofundum boonei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Aboo_1324
Enzymes [BR:abi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Aboo_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1267434..1268435)
Genome map
AA seq 333 aa AA seqDB search
MLLEKLVKAFGVPGYEGEIREIVKEHMEKYVDDVQVDTLGNVIGVKKGGERKVLLAAHMD
QIGFMVRGITEDGYLVISPMGGVNPITLRSRIVRIRGKSSYVYGVIGEKPPHIEKKAEKK
EIKDLRVDIGVEKKEEAENLVSIGDVGSFLPNYYEIGNRIVATALDDRAGIYTLLKVMED
LESETTIYFVATVQEEVGLRGAKVSGFRVEPDIGIAIDVTHARMPGMGKDEMPVELGKGP
TIGVGPTAHPKLVKHFINSANGVPYQIEPNPSRSGTDVDVIQLSREGVATVVISIPLRYM
HSSVEMIDKRDLENTIGLIRNALKGIDKVELSL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcgaaaaattggttaaagcatttggagtgccgggatatgaaggggaaataaga
gaaatcgtgaaagaacatatggaaaaatatgtggatgatgtacaagttgatacccttgga
aatgttataggcgtgaaaaaaggaggagagagaaaagtgcttttagcggcacatatggac
caaattggctttatggtcagaggtataactgaggatggataccttgtgatttcgccaatg
ggtggagtgaatccaataacgctgcgatcaagaattgtgagaataagagggaaaagtagt
tatgtttacggagtcataggtgagaagccgccccacatagagaagaaagcagagaaaaaa
gaaataaaggatttaagggtggatattggagtagaaaagaaggaagaggcagagaatttg
gtaagtataggggatgttggctctttcttgccgaattattacgagattggaaataggatt
gtagcaacggctttagatgatcgagccgggatttacacccttttgaaagtaatggaagat
ttggaaagcgagacaacaatttattttgtagctacagtgcaagaagaagttggattgagg
ggggcgaaggtctctggatttagagtggagccagatataggtatagcgattgatgtgacc
catgcaagaatgcccggaatgggtaaggacgagatgcctgtagagcttggcaaaggaccc
acaattggagtagggccaacggctcatccaaagcttgtaaagcatttcatcaatagtgca
aacggagtgccttatcaaattgagcctaatccaagcagaagtggcacggatgtcgatgtc
attcaattgtctcgtgagggagttgccactgtagttatttctattcctcttcgctatatg
cactcaagcgttgagatgattgataaaagagatttagaaaatacaatagggctgataaga
aatgcattgaagggaatagataaagttgaactaagcttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system