KEGG   Aciduliprofundum boonei: Aboo_1324Help
Entry
Aboo_1324         CDS       T01180                                 

Definition
(GenBank) peptidase M42 family protein
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
abi  Aciduliprofundum boonei
Brite
Enzymes [BR:abi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     Aboo_1324
Peptidases [BR:abi01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   Aboo_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1267434..1268435)
Genome map
AA seq 333 aa AA seqDB search
MLLEKLVKAFGVPGYEGEIREIVKEHMEKYVDDVQVDTLGNVIGVKKGGERKVLLAAHMD
QIGFMVRGITEDGYLVISPMGGVNPITLRSRIVRIRGKSSYVYGVIGEKPPHIEKKAEKK
EIKDLRVDIGVEKKEEAENLVSIGDVGSFLPNYYEIGNRIVATALDDRAGIYTLLKVMED
LESETTIYFVATVQEEVGLRGAKVSGFRVEPDIGIAIDVTHARMPGMGKDEMPVELGKGP
TIGVGPTAHPKLVKHFINSANGVPYQIEPNPSRSGTDVDVIQLSREGVATVVISIPLRYM
HSSVEMIDKRDLENTIGLIRNALKGIDKVELSL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcgaaaaattggttaaagcatttggagtgccgggatatgaaggggaaataaga
gaaatcgtgaaagaacatatggaaaaatatgtggatgatgtacaagttgatacccttgga
aatgttataggcgtgaaaaaaggaggagagagaaaagtgcttttagcggcacatatggac
caaattggctttatggtcagaggtataactgaggatggataccttgtgatttcgccaatg
ggtggagtgaatccaataacgctgcgatcaagaattgtgagaataagagggaaaagtagt
tatgtttacggagtcataggtgagaagccgccccacatagagaagaaagcagagaaaaaa
gaaataaaggatttaagggtggatattggagtagaaaagaaggaagaggcagagaatttg
gtaagtataggggatgttggctctttcttgccgaattattacgagattggaaataggatt
gtagcaacggctttagatgatcgagccgggatttacacccttttgaaagtaatggaagat
ttggaaagcgagacaacaatttattttgtagctacagtgcaagaagaagttggattgagg
ggggcgaaggtctctggatttagagtggagccagatataggtatagcgattgatgtgacc
catgcaagaatgcccggaatgggtaaggacgagatgcctgtagagcttggcaaaggaccc
acaattggagtagggccaacggctcatccaaagcttgtaaagcatttcatcaatagtgca
aacggagtgccttatcaaattgagcctaatccaagcagaagtggcacggatgtcgatgtc
attcaattgtctcgtgagggagttgccactgtagttatttctattcctcttcgctatatg
cactcaagcgttgagatgattgataaaagagatttagaaaatacaatagggctgataaga
aatgcattgaagggaatagataaagttgaactaagcttatga

DBGET integrated database retrieval system