KEGG   Aciduliprofundum boonei: Aboo_1343Help
Entry
Aboo_1343         CDS       T01180                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
abi  Aciduliprofundum boonei
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_1343
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Aboo_1343
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Aboo_1343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1288928..1290757
Genome map
AA seq 609 aa AA seqDB search
MKGYVGTIVRINLSDVRYEIEDTENYPIYDFLGGRGLGAKLLLDMTNKTTEPLSEENPLM
FLTGPYTGTPGISSAFYNVTTKAPLTRTPSGSHSGGFWGPHLKRAGFDGIIVEGRADKPV
YIYIEDGKVSIEDATNLWGKGVFETTDYLERKYPSAKIAAIGPAGENLVWYASIMNDKYR
AVGRTGAGAVMGSKLLKAIVVKGKHRVEVADPQGLKDVFAEALKNTRVKAAKVSELGTPA
MIPVTNSTGTLPTRNFQQGSYEKADNLDPKKLRYEFTKKKVACYGCPIRCSNFTEAEYEG
IRVKGEGPEYETTMAFGSNIDNDDYNLLIVANALCNDYGMDTITAGDTIAFFMELYERGI
LTKEEVDNLDFRFGNKEIILDLLHKIAKREGVGELLSLGVREASKRIGRGSERYAIHVKG
LEPPGYDPRGSVGMGLNYATSNRGACHLRAAMYVPELLYKTMDRFQIRGKHEYIRDFQNV
LAVVDSMIMCKFGSRYGYLDDADTIAKALTVVTGYEYSGEEILKIGDRIWNMERLFLLRE
GYTHRDDTLPERFFEEPVDVGNGDKRAINKEEFHQAIKDWYRARGWDESGRPTRWKLEEL
GLDEYIGKF
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggtatgttggcactatagtgagaataaatttaagtgatgtgcgctatgaaatt
gaagacactgaaaattatcccatctatgattttctaggtggccgaggacttggagccaaa
cttcttttagatatgaccaataaaaccacggaaccattaagcgaggaaaatcccttgatg
tttctcacaggcccttatacgggaactccagggatatcatctgccttttacaatgtcaca
actaaagcacctttaacaagaactccatcgggctcgcattctggaggattctggggacca
catttgaagagggcagggttcgatggaataatcgtagagggaagagcagataagcctgta
tatatttatattgaagatggaaaggtaagcatagaggatgccactaatttatggggaaag
ggagtatttgaaaccaccgattatctggagagaaagtatccttcggctaaaattgcagcc
ataggaccagcaggagagaatttagtttggtatgcatccattatgaatgataaatatagg
gcagtgggtagaactggggcaggagctgttatggggagcaagctacttaaggcaatagtg
gtaaaagggaaacacagggttgaagttgcagacccacagggattaaaggatgtgtttgca
gaggctttgaaaaacacaagggtgaaagccgccaaagtttctgagttgggtacccctgca
atgattcctgtcacaaattctacaggtacattacccacaagaaactttcagcagggatca
tatgaaaaggctgataatttggatccaaagaagctgcgatacgagtttacgaagaaaaag
gtggcttgctatgggtgtcctatcagatgctctaattttaccgaagcagaatatgaagga
ataagagtgaaaggtgaagggccagagtatgagaccaccatggcctttggctccaatatt
gacaatgacgattacaatctcttaatagtggccaatgctctttgcaatgattacggtatg
gataccataaccgctggagacacaattgccttctttatggagctttatgagaggggaatc
ctaactaaggaggaagtggataacttggatttcagatttggaaacaaggagataatattg
gatcttctgcacaagattgcaaaaagagagggcgtgggcgaacttctatctttaggcgta
agagaagcttccaagcgtataggaaggggctctgagagatatgcgattcatgtaaaagga
ttggagcctccaggatacgatcccagaggaagtgtgggaatgggattgaattatgctacg
agcaacagaggcgcatgtcatttgcgagcagctatgtatgtgcccgagctactatacaag
acaatggataggttccaaataaggggcaagcatgagtatataagagattttcaaaacgta
cttgccgttgtggattccatgataatgtgcaaatttggaagtcgttatggatacttggat
gatgcagacactattgccaaagctctgacagtggttacaggctatgagtactcgggagag
gaaatactaaagataggggataggatatggaacatggagagactctttctccttagagaa
ggatatacccacagagacgataccttgcccgagagattctttgaggagcctgtggatgtt
ggtaatggagataagagagctattaacaaagaagagttccatcaggccataaaagattgg
tatagagcgagaggatgggatgaaagtggaaggcccacaagatggaaattggaagaattg
ggattggatgaatatattggaaaattttga

DBGET integrated database retrieval system