KEGG   Aciduliprofundum boonei: Aboo_1355Help
Entry
Aboo_1355         CDS       T01180                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abi  Aciduliprofundum boonei
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Aboo_1355
Enzymes [BR:abi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Aboo_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1299880..1300455
Genome map
AA seq 191 aa AA seqDB search
MWQEISKFGKKLVEQGLVSSHFGNISVRVGEYMYITRSGSMLDEITKDDVVRVSIYEPTS
LDLIASSEVTAHREIYKNTSALAIIHDHSPFAVIESLIHREQGKERIVPIDSEGSYFLHD
IPIVEGGIGTEKLANNLARALEERKAAVVYSHGVFARGSILEEAFVVASMVEHSCKMMYY
FDIWKDMNKLP
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaagagatttcaaaattcggtaagaagcttgttgagcaaggacttgtaagctcc
cattttggaaacataagcgttcgtgttggggagtatatgtacataactcgctcaggctcg
atgctggatgaaataacaaaggatgatgtcgttcgtgtttcaatctacgagccgacctcg
ttggatttaattgcctcttcggaggtaacggcacatcgggagatttacaaaaacacatct
gcacttgcaataattcacgatcattctccatttgcagttattgaatccttaattcataga
gaacaaggcaaggagagaattgtacctattgatagcgaaggctcatatttcttacacgat
attcccatcgtggaaggaggaataggtactgagaaacttgcaaacaatcttgccagggca
ctggaggagagaaaggcggccgtggtttattcccatggtgtatttgctcggggcagcatt
ttagaggaggcttttgttgtggcgagtatggtagagcattcttgcaagatgatgtactat
ttcgatatctggaaagatatgaacaaattaccctag

DBGET integrated database retrieval system