KEGG   Aciduliprofundum boonei: Aboo_1359Help
Entry
Aboo_1359         CDS       T01180                                 

Definition
(RefSeq) cobalamin B12-binding domain protein
  KO
K01849  
methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
abi  Aciduliprofundum boonei
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_1359
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Aboo_1359
   00640 Propanoate metabolism
    Aboo_1359
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Aboo_1359
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aboo_1359
Enzymes [BR:abi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Aboo_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1302853..1303239
Genome map
AA seq 128 aa AA seqDB search
MMRKRILIAKVGLDGHDRGAKVVARALKNAGFEVIYTGIRQSPEQVVETAIQEDVDLIGL
SCLSGAHIPLFKRVMEIMKEKGVNIPVFCGGTIPPGDVEALKRMGIKEVFGPGAPLKLIV
EKVRIWVK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaaaagaatactcattgctaaggttggcctagacgggcatgaccgcggagca
aaggttgtggctagggccttgaagaatgctggttttgaggttatttacactggaataaga
cagagtcctgaacaggtggttgaaactgcaatacaggaggatgtggatctaatagggcta
agttgtctttcaggtgcgcatattccactatttaaaagggttatggagattatgaaagag
aagggcgtaaacatacctgtattttgtggaggcactatacctccaggagatgttgaagcc
ctgaagaggatggggattaaagaggtgtttgggcccggtgcgcccctgaaacttattgta
gagaaggtgaggatatgggtaaaatag

DBGET integrated database retrieval system