KEGG   Aciduliprofundum boonei: Aboo_1359Help
Entry
Aboo_1359         CDS       T01180                                 

Definition
cobalamin B12-binding domain protein
Orthology
K01849  
methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
abi  Aciduliprofundum boonei
Pathway
Valine, leucine and isoleucine degradation
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:abi01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:abi00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:abi00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1302853..1303239
Genome map
AA seq 128 aa AA seqDB search
MMRKRILIAKVGLDGHDRGAKVVARALKNAGFEVIYTGIRQSPEQVVETAIQEDVDLIGL
SCLSGAHIPLFKRVMEIMKEKGVNIPVFCGGTIPPGDVEALKRMGIKEVFGPGAPLKLIV
EKVRIWVK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaaaagaatactcattgctaaggttggcctagacgggcatgaccgcggagca
aaggttgtggctagggccttgaagaatgctggttttgaggttatttacactggaataaga
cagagtcctgaacaggtggttgaaactgcaatacaggaggatgtggatctaatagggcta
agttgtctttcaggtgcgcatattccactatttaaaagggttatggagattatgaaagag
aagggcgtaaacatacctgtattttgtggaggcactatacctccaggagatgttgaagcc
ctgaagaggatggggattaaagaggtgtttgggcccggtgcgcccctgaaacttattgta
gagaaggtgaggatatgggtaaaatag

DBGET integrated database retrieval system