KEGG   Aciduliprofundum boonei: Aboo_1359Help
Entry
Aboo_1359         CDS       T01180                                 

Definition
cobalamin B12-binding domain protein
Orthology
K01849  
methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
abi  Aciduliprofundum boonei
Pathway
Valine, leucine and isoleucine degradation
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_1359
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Aboo_1359
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Aboo_1359
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aboo_1359
Enzymes [BR:abi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Aboo_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1302853..1303239
Genome map
AA seq 128 aa AA seqDB search
MMRKRILIAKVGLDGHDRGAKVVARALKNAGFEVIYTGIRQSPEQVVETAIQEDVDLIGL
SCLSGAHIPLFKRVMEIMKEKGVNIPVFCGGTIPPGDVEALKRMGIKEVFGPGAPLKLIV
EKVRIWVK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaaaagaatactcattgctaaggttggcctagacgggcatgaccgcggagca
aaggttgtggctagggccttgaagaatgctggttttgaggttatttacactggaataaga
cagagtcctgaacaggtggttgaaactgcaatacaggaggatgtggatctaatagggcta
agttgtctttcaggtgcgcatattccactatttaaaagggttatggagattatgaaagag
aagggcgtaaacatacctgtattttgtggaggcactatacctccaggagatgttgaagcc
ctgaagaggatggggattaaagaggtgtttgggcccggtgcgcccctgaaacttattgta
gagaaggtgaggatatgggtaaaatag

DBGET integrated database retrieval system