KEGG   Aciduliprofundum boonei: Aboo_1429Help
Entry
Aboo_1429         CDS       T01180                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Aboo_1429
Enzymes [BR:abi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Aboo_1429
Exosome [BR:abi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aboo_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1363587..1365026
Genome map
AA seq 479 aa AA seqDB search
MTRILAMDEGTTNVKASIVDEEGKIISSLSKEFNQIYPKPGWVEHEPEEIWRTQVEVAKK
ITKNERIDAIGITNQRETVVVWDKNGKPIYNAIVWQCRRTADMMEEIKKEYGEIIREKTG
LIADAYFSASKIKWLLDNVPRARERAKMRELMAGTIDSYLIYKLTGEHLTDHSNASRTML
FNIKKGEWDEELLELFGIPKDILPHVRDSSSVFGYTKLFGKEVPVSGVLGDQQAALFGQT
CFSKGMLKVTYGTGNFLLANTGNEIEHSENLLTTVAWKIKGNTTYALEGSVFITGAALKW
LKDLEILKDYDDSENLAKNAKDSKLFFVPAFSGLGSPYWDPHARGLLIGITRGTKKEDIV
KATLDSIAYQTKDVVEEMKKQVKIKEIRVDGGASKNDYLMQFQSDILGIPVLRPAILETT
SLGAAFMAGLTIGAWDMNDLKGLWKEDRRFEPKMKDEDREKLYKRWKDAVSRALGWAKE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaattcttgcaatggatgagggtacaaccaatgtaaaagcgtcaattgttgat
gaggagggaaagattatttcttccctatcaaaagaattcaatcagatttatcctaaacca
ggttgggttgagcacgagcctgaggagatatggagaactcaagtagaagttgctaagaaa
ataacaaaaaatgagagaatagatgcaataggcataacaaatcagagagagaccgtagtg
gtgtgggacaagaatggaaagccaatctacaacgcaatagtgtggcagtgtagaagaact
gctgatatgatggaagagataaaaaaagagtatggtgagataataagagagaaaacaggg
ctgatagcggatgcatatttctctgccagcaagataaaatggctcttagataatgttcca
cgagccagagaaagagcaaaaatgagagagcttatggccggtacgatagattcttacctt
atttacaaacttacaggtgagcatctcaccgatcattccaatgcctcaagaaccatgctc
ttcaacataaaaaaaggagaatgggatgaagagcttcttgagttattcggcatccctaaa
gatatccttccgcatgttagagattcaagcagtgtatttgggtacacaaaattatttgga
aaggaagtgcctgtaagtggagttttaggagaccagcaggctgcattgtttggacaaacc
tgcttctcaaaaggcatgctcaaagtgacttatggtacgggaaatttcttgctggcaaac
actggaaatgaaatagaacattcagagaatctattgaccaccgtggcttggaagataaaa
ggaaataccacctatgcccttgaaggaagcgtgttcataacgggtgctgctttaaaatgg
cttaaagatttggaaattttgaaagattacgatgatagtgagaatctggcaaaaaatgct
aaagattcaaaattatttttcgttccggcattctcgggccttggctctccctactgggac
cctcatgcaagaggtttgctaatagggataacgagaggcacaaaaaaagaggatatagtg
aaagctaccttagattccatagcgtatcaaactaaagatgttgtagaagaaatgaaaaaa
caggtaaaaattaaagaaattagagtggatggtggcgcttctaaaaatgattatcttatg
caatttcaatctgatatcttaggcatacctgttctaaggccagcaatcctagaaacaaca
tcgctaggcgcagcgtttatggcaggtctcactataggtgcttgggatatgaacgattta
aagggattatggaaagaagatagaagatttgagcccaaaatgaaagatgaggatagagaa
aaattgtataaaagatggaaagatgccgtatcaagagctctaggttgggctaaggagtag

DBGET integrated database retrieval system