KEGG   Aciduliprofundum boonei: Aboo_1437Help
Entry
Aboo_1437         CDS       T01180                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00010  Glycolysis / Gluconeogenesis
abi00020  Citrate cycle (TCA cycle)
abi00620  Pyruvate metabolism
abi00640  Propanoate metabolism
abi00650  Butanoate metabolism
abi00680  Methane metabolism
abi00720  Carbon fixation pathways in prokaryotes
abi01100  Metabolic pathways
abi01120  Microbial metabolism in diverse environments
abi01130  Biosynthesis of antibiotics
abi01200  Carbon metabolism
Module
abi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_1437
   00020 Citrate cycle (TCA cycle)
    Aboo_1437
   00620 Pyruvate metabolism
    Aboo_1437
   00640 Propanoate metabolism
    Aboo_1437
   00650 Butanoate metabolism
    Aboo_1437
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Aboo_1437
   00680 Methane metabolism
    Aboo_1437
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Aboo_1437
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Aboo_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ADD09244
JGI: Aboo_1437
UniProt: B5IB96
Position
complement(1373345..1374238)
Genome map
AA seq 297 aa AA seqDB search
MNYEKEEFFAPGHGMCAGCAAPIIVKWVLKLAGPNTIVVNATGCLEVATTAYPRTSWRVP
WLHVAFENAAAAASGIEAAARAKGEKLNIIAFGGDGGTADIGFQALSGMVERGHNVLYVL
YDNEAYMNTGIQRSGATPWGAWTTTSKVGSANPIGKLQPKKPVARIIAAHNAKYVATANP
AIFNDFKKKVQKALSYEGARFLHVISSCTTGWRHDPSKTVEIMKLASDTGIFPLWEVVDG
DLENMRITYKPKKFKPVEEYLKPQGRFRHLLKNPEYVKKLQEQVDAWWAKYGHHYNP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaaaaagaagagttttttgcaccggggcacggaatgtgcgctggttgcgct
gcacccataatcgtcaaatgggttctcaaacttgctggtcctaatacaatagtagttaat
gctacaggatgtttggaagttgcaacaacggcatatcctcgcacctcttggcgcgtacct
tggctccatgtggcctttgaaaacgctgccgctgcggccagtggtattgaagcagctgcc
cgtgcaaagggtgagaaattgaatataattgcgtttggtggcgatggcggtactgcggat
ataggattccaagcactcagtggtatggttgagcgtggacataatgtattgtatgttctc
tacgataatgaggcgtatatgaacacaggcatacagagaagcggagccacgccttggggc
gcttggacaacaactagcaaggtaggaagtgcaaatccaattggaaaattacagcctaaa
aaacctgtggctagaataatagcagcccataatgccaagtatgtcgccacagcaaatccg
gcgatattcaatgatttcaagaagaaagtacaaaaggcattaagttacgagggtgcaaga
ttcttgcatgtcatatcctcttgcaccactggatggagacatgacccaagcaaaactgtt
gagataatgaaacttgcatccgatactggtatattcccgctctgggaagttgttgacgga
gaccttgagaatatgcgcataacatacaagccaaagaaattcaagccagttgaggagtat
ctgaaaccgcaggggagatttaggcatcttcttaagaatccagagtatgtgaaaaaattg
caagagcaagttgatgcttggtgggccaagtacggacatcactataacccataa

DBGET integrated database retrieval system