KEGG   Aciduliprofundum boonei: Aboo_1440Help
Entry
Aboo_1440         CDS       T01180                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, gamma subunit (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aboo_1440
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_1440
   00020 Citrate cycle (TCA cycle)
    Aboo_1440
   00620 Pyruvate metabolism
    Aboo_1440
   00640 Propanoate metabolism
    Aboo_1440
   00650 Butanoate metabolism
    Aboo_1440
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Aboo_1440
   00680 Methane metabolism
    Aboo_1440
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Aboo_1440
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Aboo_1440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1375753..1376304)
Genome map
AA seq 183 aa AA seqDB search
MYEVRFHGRGGQGAVTAANILAIAAVKQGFYAQSFPYFGVERRGAPVQAFTRIDDKKIDV
RMNVYNPDAVVVLDPSLMDVIDVTEGLKEGGIIVINTAKKPEEFNLGNYKIATVDATRVA
LEHKLGSMAAPIVNTAILGAYAKAVGNVKIEYVLEAIRENAPAKKEENALAAEDAYKQTV
LGW
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaagtaagattccatggaagaggaggccagggagccgttacggcggccaatatt
ctggccatagcagcagtgaagcaagggttctacgctcaatcgtttccctattttggcgtg
gagcgcagaggtgcacctgtacaagcgtttactagaattgatgacaagaaaatcgatgtg
agaatgaatgtgtacaatccagatgctgttgtggtgcttgacccttcccttatggatgtc
attgatgttaccgagggcttgaaggaggggggaattatagtgattaacactgcaaagaag
ccagaggagtttaatcttggaaattacaagattgcaacagttgatgctacaagagtcgct
ttggaacataaacttggctccatggctgcgcccatagtgaatacagcaattcttggagct
tatgccaaagcagttggaaatgtgaaaattgagtatgtgcttgaggcaattcgtgagaat
gctcctgctaaaaaggaggaaaacgctttagcggcggaagatgcctacaaacaaactgta
ttggggtggtaa

DBGET integrated database retrieval system