KEGG   Aciduliprofundum boonei: Aboo_1538Help
Entry
Aboo_1538         CDS       T01180                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abi  Aciduliprofundum boonei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_1538
   00030 Pentose phosphate pathway
    Aboo_1538
   00051 Fructose and mannose metabolism
    Aboo_1538
   00052 Galactose metabolism
    Aboo_1538
   00500 Starch and sucrose metabolism
    Aboo_1538
   00520 Amino sugar and nucleotide sugar metabolism
    Aboo_1538
  Nucleotide metabolism
   00230 Purine metabolism
    Aboo_1538
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Aboo_1538
Enzymes [BR:abi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Aboo_1538
    5.4.2.8  phosphomannomutase
     Aboo_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1470347..1471699
Genome map
AA seq 450 aa AA seqDB search
MRLFGTNGIRGKIGEEFTPDFLVNVGRAIGTYLPLGSDVILGTDTRVSANMVKDAVISGL
LSAGVNVIDIGIAPTPAIQLYTKRHGDFGIAITASHNPPEFNGVKAIASDGTELPRSEEE
KIEEIYFSGQFRNVEWNNVGSYEIREDANEEYVNSILSLVDTNRIKEKHFKVVLDCANGA
SCFTSPYLLEKLGCKVISLNCQPDGRFPGHNSEPKPENLKDLVDMVKATNADLGIAHDGD
ADRAIFVDDRGRYLYGDKTLALVAKEIVKERKGIVVTPVSSSLALEDVVKKEGGEVVYTK
VGAPIVARKMIELHAIFGGEENGGLIFPEHQYCRDGAMALAKILEILAKKEKKLSELADE
LPKYKQMKISVACENEKKEKVLEELKKRVMGENVNTLDGIKIMGKDWWVLIRPSGTEPIY
RIYAEAKDENILKKKVEKYKEILKNIIKSE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttattcggcacaaacggaattcgaggcaagattggcgaagagttcactccggat
ttcttggttaatgtaggccgtgcaattggaacatatttgccccttggctcagatgtgata
cttggaacagatacaagggtttctgcaaatatggtgaaagatgctgtaatatccggactt
ctttcagcaggggtaaatgttatagacataggtatagctccaactcccgcaatacaactc
tacacaaagagacatggggattttggaatcgccataactgcaagtcataatcctccagaa
ttcaatggagtaaaggcgatagcttcagatggaacagaactgccaaggagcgaggaggag
aaaatagaggaaatatatttctcaggccaattcagaaatgtggaatggaataatgttggg
agttatgaaataagagaagatgcaaatgaggagtatgtaaattccattctttccctagtt
gatacgaataggataaaagaaaagcacttcaaggtggtacttgattgcgcaaatggtgct
tcctgctttacatctccatatctcctcgaaaagcttgggtgcaaggtaatatcactaaat
tgccagccagatggcaggttccctgggcacaacagcgagccaaaaccagaaaacttgaaa
gaccttgtggatatggttaaggctacaaatgcagatttaggaatagctcatgatggggat
gctgaccgtgccatatttgtagatgatagaggaagatacctgtatggggataaaaccttg
gccttagttgcaaaggagattgtaaaggaaagaaagggtattgtagtaactccagtgagc
tcctctctggctcttgaagatgttgttaagaaggaggggggagaggtagtgtatacaaaa
gtaggcgctccaatagtggcaaggaagatgattgaacttcatgcaattttcggtggagag
gagaacggtggactaatattcccagagcatcagtactgcagagatggagcaatggcctta
gctaagattcttgaaatcttggcaaagaaagagaaaaaattgagtgaacttgcagacgaa
cttccaaaatataagcagatgaaaataagtgtggcatgtgagaacgagaaaaaagagaaa
gtgctggaagaattgaaaaaaagagtaatgggagagaatgtaaatacattggacgggata
aaaattatgggtaaggactggtgggttttaatccgcccctcaggtacggagccaatttac
aggatttatgcagaggcaaaggatgaaaatattttaaagaagaaagttgagaagtataaa
gaaatattaaaaaacataataaaaagtgagtaa

DBGET integrated database retrieval system