KEGG   Aciduliprofundum boonei: Aboo_1540Help
Entry
Aboo_1540         CDS       T01180                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
abi  Aciduliprofundum boonei
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:abi01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:abi00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1473024..1474838
Genome map
AA seq 604 aa AA seqDB search
MYGYHGKIVRINLSTGKISVENIDENFAKKWLGTRGFGIHTLLKEIDPKVDPLSEENKII
YSTGPLTGTAAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDYLIVEGKSENPV
YISIKDDNIEIKDASHIWGKKVSETEKILLEEFGDKHAQIASIGPAGENLVKFSAIMNNG
HRAAARGGVGAVMGSKKLKAIIVRGHNKTPLADRQKFISVVKEKINKLKNDPVAGSGLPK
YGTAVLVNIINQNGLYPTRNFRTGVFEYAEEQSGEAMAAKYLKRNKPCYACPIGCGRVNV
ISSVGETEGPEYESLWALGAHLGINDLGSIIEANHICDEMGLDTISTGGTLATAMELYDK
GILKQEDLGDAPPFRFGNTEVIHYYIEKIAKREGFGAKLAEGGYRLAESYGYTDAFMGVK
KQELPAYDPRGAEGHGLGYATDNRGGDHIKAYMISPEILGYPVKMDPHDISDEKVKMLIL
FQNLTALIDAAGLCIFTTFGLGADDYRDMLNAALGWDLSTEDYLKIGERIWNAERLFNLK
AGLTTEEDTLPKRLTEEPMPEGPNKGHVVHLKEMLPRYYALRGWNARGEITKEKIKELDL
EEYF
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtatggatatcatggaaaaatagtcagaataaacttatccacgggaaaaatatccgtg
gaaaatattgatgaaaattttgcaaaaaaatggctgggtacaaggggctttggaatacat
acccttctaaaagagattgatccaaaggtggacccattaagcgaggaaaataaaataatc
tattccacaggtcccttgactggaactgcagcgccaactggtgggaggtatatggtcata
accaagagtcctctcacagggtatatcgcaatggcaaactctggtggtttcttcggtgca
gaactcaagtttgctggttgggattatctcatagtggaaggaaagagcgagaatcctgtg
tacatctcaataaaagatgataatatagagataaaggatgcctcacatatttggggcaag
aaagttagcgagacggagaaaattctattggaggaatttggagacaagcatgctcagatt
gcttcaataggcccagctggtgagaaccttgtgaaattctccgccattatgaacaatggg
catcgagcagcagccagaggtggtgtaggagcagttatgggaagtaagaagttaaaagcg
atcatagtaaggggccataataaaacgcctttagcagatagacagaaattcataagcgtt
gttaaggagaaaattaataaattgaaaaatgaccccgtggctggcagcggtttgccaaag
tacggaactgctgtgcttgtaaatatcataaatcaaaatggattgtaccctacgagaaat
ttcagaacaggagtgtttgaatatgcggaagagcagagcggagaggcaatggcagccaag
tacttgaaaaggaataagccctgctatgcctgcccaatagggtgcgggagagtcaatgtt
ataagctctgtgggcgagacagaggggccagagtacgaaagtttatgggcactgggtgcg
catctgggcataaacgatttaggaagtatcattgaggcaaaccatatatgcgatgaaatg
ggtctcgatacaatatccactggaggtactttagcaactgcgatggagttatacgacaag
ggtattttgaagcaggaagatttgggagatgcacccccattcagatttggaaacacagag
gtgatacattattacatcgagaagatagccaagcgcgagggatttggtgcaaagttagcg
gaaggaggatacagacttgcggaaagctacggatacacagacgcatttatgggagtgaag
aagcaagagcttcctgcctatgatccaaggggagcagaaggccatggactgggatatgca
acagataatcgaggaggagatcacataaaagcgtatatgattagccctgaaattcttggt
tatcctgttaagatggacccgcatgatataagcgatgagaaggtgaaaatgctcattcta
ttccaaaacttgaccgctttgatagatgctgcggggctttgcatattcactacatttggc
ttaggagctgatgattatcgggatatgctcaatgctgctctaggttgggatttaagcacg
gaagattatctaaagattggcgagcgtatatggaatgctgagcgtttattcaatttaaaa
gcaggattaaccacggaagaggatacacttcccaagcgcttaaccgaggagccaatgccc
gaaggaccgaataaggggcatgtggtgcacttgaaagaaatgcttccacggtactatgct
ctgagaggatggaatgctcggggagagataacaaaggagaagataaaggagctcgacttg
gaagaatacttctaa

DBGET integrated database retrieval system