KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_00238Help
Entry
BJAB07104_00238   CDS       T02726                                 

Definition
Ribulose-5-phosphate 4-epimerase-related epimerase and aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BJAB07104_00238
Enzymes [BR:abj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BJAB07104_00238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(261361..262137)
Genome map
AA seq 258 aa AA seqDB search
MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDHGHDAGLAGQITCRSEN
KETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANRFHTWIYKEHPEVNCIIHT
HPTYVAALSMLQIPLMISQMDVCALYEDCSFVGHWPGVPVGNEEGILISSALGKNRAVLL
SHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIPHALAAEAHDWVSTDKRNK
VNFAYYARKALKKHSDCI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcttctgtaaacaaacacgacttgatgcaacacgcacagcaagacatgcaa
aagtggattagcgacttagatttaacagaccgtcaaaagcttgcactgacttgccgtatt
ttatttgatcatgggcatgacgctggtttagcgggtcaaattacatgccgtagtgaaaat
aaagaaacctttattactcaacgtttcggtttaggttttgatgaaattactgcttcaaac
ttgcttgaggtgaatcaggacttagaacccatcaatcaagaaggcatggcaaacccagcc
aaccgtttccacacatggatttataaagaacacccagaggtgaactgtattatccatacg
catcctacctatgtagcggccctgtcgatgctacagattccacttatgatttcccaaatg
gacgtctgcgcactttacgaagattgctcatttgtaggccattggccgggtgttcctgta
ggcaacgaagaaggtattttgatttcttctgctctgggtaaaaaccgcgctgttttgttg
tctcaccacggtcaactggtcacaggaaaaactatcgaagaagcctgtaacttggctctt
ttaattgaacgcgcagctcaactgcaacttttagccatgtctgccggacaaatccagcct
atcccccacgctttggcagcagaagcccatgattgggtgtctactgataaacgcaacaaa
gtgaactttgcttactacgcacgtaaagctttgaaaaaacattctgactgtatttaa

DBGET integrated database retrieval system